Gesellschaft Medien Politik Wirtschaft Wissenschaft

Nord Stream vs. 9/11

“EU Harakiri”on Behalf of Washington. The Nord Stream Destruction, Is the EC Planning to Destroy the European Union?
02.12.2022, 16:52 Uhr. Global Research – https: – All Global Research articles can be read in 51 languages by activating the Translate This Article button below the author’s name. To receive Global Research’s Daily Newsletter (selected articles), click here. Follow us on Instagram and Twitter and subscribe … The post “EU Harakiri”on Behalf of Washington. The Nord Stream…

Nord-Stream-Bräu: Bundesregierung sendet Opfersignale
02.12.2022, 15:02 Uhr. Blauer Bote Magazin – Wissenschaft statt Propaganda – blauerbote.com – Die Nord-Stream-Thematik wurde innerhalb von 1-2 Tagen in den Medien von fast „0“ auf „100“ gefahren. Zwei Artikel dazu, der erste vom 2.12.2022, der zweite vom 1.12.2022: Gestern hier vorhergesagt: Nord Stream heute Medienthema, Fake im Anflug Tagesschau heizt mit Greenpeace das Nord-Stream-Thema an: Steht die Beschuldigung…

Gestern hier vorhergesagt: Nord Stream heute Medienthema, Fake im Anflug
02.12.2022, 13:31 Uhr. Blauer Bote Magazin – Wissenschaft statt Propaganda – blauerbote.com – Wie bereits gestern spekuliert – oder vorhergesagt – wird das bisher eher vertuschte Thema „Nord Stream“ von den „Meinungsbildnern“ aufgekocht, um den höchstwahrscheinlichen Tathergang quasi völlig umzudrehen und den Feind zu beschuldigen, obwohl man doch selbst der Täter ist. Das Vorgehen erinnert stark an den…

Tagesschau heizt mit Greenpeace das Nord-Stream-Thema an: Steht die Beschuldigung Russlands unmittelbar bevor?
01.12.2022, 18:16 Uhr. Blauer Bote Magazin – Wissenschaft statt Propaganda – blauerbote.com – Nord Stream wurde „nach menschlichem Ermessen“ von den USA oder in deren Auftrag gesprengt. Neu-NATO-Schweden hat sich die „Unfallstellen“ unter den Nagel gerissen. Jetzt brachte die Tagesschau am 30.11.2022 einen Greenpeace-Einsatz vor Ort und damit das Thema, welches in den letzten Wochen eisern totgeschwiegen wurde, wieder…

Sprengung der deutschen Nord-Stream-Pipeline durch die USA – Bevölkerung soll dankbar für Entlastungspakete sein
30.11.2022, 14:41 Uhr. Blauer Bote Magazin – Wissenschaft statt Propaganda – blauerbote.com – Die deutsche Bundesregierung deckt die Sprengung der für die Erdgasversorgung Deutschlands wichtigen Nord-Stream-Pipelines durch die oder im Auftrag der USA. Zugleich lehnt die Bundesregierung Gaslieferungen über einen offenbar wieder funktionsfähigen Nord-Stream-2-Strang offiziell ab. Andere Lieferwege werden ebenfalls „sanktioniert und sabotiert“…

WM-Spiel USA gegen Iran – USA töten iranischen General
29.11.2022, 20:05 Uhr. Blauer Bote Magazin – Wissenschaft statt Propaganda – blauerbote.com – Nord-Stream-Sprenger mit Doppelwumms gegen Iran? Tagesschau: „WM-Duell Iran gegen USA. Die Zeit der Blumen ist vorbei„: „1998 schenkte Irans Nationalelf den US-Spielern vor dem Anpfiff Blumen – ein Friedenszeichen, aus dem nichts wurde. Heute treffen beide Teams in Katar erneut aufeinander. Zeichen des guten Willens sind nicht…

Tagesschau: Deindustrialisierung durch gestiegene Gaspreise – Bundesregierung verweigert Annahme von Nord-Stream-Gas
28.11.2022, 22:03 Uhr. Blauer Bote Magazin – Wissenschaft statt Propaganda – blauerbote.com – Tagesschau am 28. November 2022: „Energiekrise bedroht Industrie„: „Die extrem gestiegenen Gaspreise könnten einer Studie zufolge im schlimmsten Fall eine Deindustrialisierung in Deutschland und Europa auslösen. Auch die Lieferengpässe kosteten zuletzt Wertschöpfung in Milliardenhöhe. (…) Besonders hart von den explosionsartig…

Offener Brief an Zürichs führende Zeitung: “Ein Schritt in Richtung weiterer Unterdrückung und Tyrannei”. Medien haben die Pflicht, die Wahrheit zu sagen
28.11.2022, 21:24 Uhr. >b’s weblog – https: – “Darum ist es wichtig: Wegen der westlichen Sanktionen hat Russland Mitte Juni die Erdgaslieferungen über die Nord Stream 1-Pipeline nach Europa gestoppt. Da mit Gas auch Strom erzeugt wird, droht nun eine Stromlücke. Die Schweiz steckt in einem Dilemma: Weil das Land keine eigenen Gasspeicher hat, ist es auf Importe angewiesen. Das fehlende Stromabkommen…

Die Bundesregierung deckt weiter den Militärschlag der USA gegen die deutsche Nord-Stream-Pipeline
28.11.2022, 10:31 Uhr. Blauer Bote Magazin – Wissenschaft statt Propaganda – blauerbote.com – Der Pharisäer von Schloss Bellevue28.11.2022, 09:54 Uhr. >b’s weblog – https: – Nach seiner Wiederwahl zum Bundespräsidenten am 13. Februar 2022 hatte Frank-Walter Steinmeier nichts anderes zu tun, als dem russischen Präsidenten Wladimir Putin in deutlichen Worten die Verantwortung für die Eskalation im Ukraine-Konflikt zuzuweisen…

Der Pharisäer von Schloss Bellevue
28.11.2022, 09:54 Uhr. >b’s weblog – https: – Nach seiner Wiederwahl zum Bundespräsidenten am 13. Februar 2022 hatte Frank-Walter Steinmeier nichts anderes zu tun, als dem russischen Präsidenten Wladimir Putin in deutlichen Worten die Verantwortung für die Eskalation im Ukraine-Konflikt zuzuweisen. Er ließ sich sogar zu einem Appell an Putin “Lösen Sie die Schlinge um den Hals der Ukraine”…

EU-Politiker beginnen Schaden der Unterwerfung unter USA zu begreifen
28.11.2022, 07:17 Uhr. tkp.at – https: – Die USA haben die EU-Politiker in Sanktionen gehetzt, die niemanden mehr schaden als den europäischen Staaten selbst. Und um jeden Versuch zu vermeiden sich unabhängig aufstellen zu können, wurden die Nord Stream Pipelines gesprengt. Langsam aber scheinen zumindest einige europäische Politiker zu begreifen was sie angerichtet haben und noch immer…

Offener Brief an die NZZ: «Ein Schritt zur weiteren Unterdrückung und Tyrannei»
26.11.2022, 10:25 Uhr. Transition News – https: – Guten Tag Redaktion, Am 23. November haben Sie geschrieben: «Darum ist es wichtig: Wegen der westlichen Sanktionen hat Russland Mitte Juni die Erdgaslieferungen über die Nord-Stream-1-Pipeline nach Europa gestoppt. Da Strom auch durch Gas erzeugt wird, droht daher eine Strommangellage. Die Schweiz ist dabei in einer Zwickmühle: Weil das Land keine…

Bürgerenergie contra Plattformwirtschaft
24.11.2022, 16:50 Uhr. Home – https: – Die Energiewendebewegung hatte große Hoffnungen auf die grüne Regierungsbeteiligung gesetzt. Inzwischen kehrt Ernüchterung ein. Die Energiepolitik hierzulande wird nach wie vor jenseits des Atlantiks bestimmt. Und dabei spielt die Plattformökonomie seit der Pandemiepolitik eine wichtige Rolle. Das betrifft auch die Erneuerbaren Energien und ihre…

Oskar Lafontaine: „Die USA haben Nordstream zerstört“
23.11.2022, 12:38 Uhr. Blauer Bote Magazin – Wissenschaft statt Propaganda – blauerbote.com – Interview-Video bei Youtube: „Die USA haben Nordstream zerstört“ – Punkt.PRERADOVIC mit Oskar Lafontaine „Ein Gespräch über ‚die dümmste Regierung Europas‘, die Zerstörer der Nordstream-Pipelines, Propaganda und die Frage: wird seine Frau, Sahra Wagenknecht die Politlandschaft mit einer eigenen Partei aufmischen?“…

Oskar Lafontaine: Die USA haben Nordstream zerstört – und sie sind Wiederholungstäter
23.11.2022, 12:24 Uhr. Report24 – https: – Deutschland ist nicht mehr als ein Vasall der USA: Es ist nicht das erste Mal, dass der ehemalige SPD- und später Linken-Politiker Oskar Lafontaine diesen Standpunkt erörtert. Im Interview mit der Journalistin Milena Preradovic ruft er eindringlich zur Selbstbehauptung gegenüber den USA auf. Auch die Hintergründe der Zerstörung der Nordstream-Pipelines…

Leserbriefe zu „Baerbock und Habeck: Auftragskiller des deutschen Mittelstandes?“
22.11.2022, 13:01 Uhr. NachDenkSeiten – Die kritische Website – https: – Christian Kreiß hinterfragt hier insbesondere die Politik von Bundesaußenministerin Baerbock und Bundeswirtschaftsminister Habeck. Sie seien maßgeblich am Niedergang des Mittelstandes, dem Rückgrat unseres Wohlstandes , beteiligt. Die grüne Politik unterstütze die Interessen der internationalen Großkonzerne. Die Lösung…

Polen greift Deutschland an und gibt Russland die Schuld
22.11.2022, 06:00 Uhr. Free21.org – https: – Die Militäroperation am Montagabend, bei der Löcher in die Gas-Pipelines Nord Stream I und II auf dem Grund der Ostsee nahe der Insel Bornholm gesprengt wurden, wurde von Spezialkräften der polnischen Marine ausgeführt. Unterstützt wurden sie vom dänischen und schwedischen Militär, Planung und Koordination mit nachrichtendienstlicher und technischer…

“Ami, it’s time to go”
21.11.2022, 20:02 Uhr. reitschuster.de – https: – „Eine aggressive Weltmacht wie die USA können keinem Verteidigungsbündnis vorstehen“, sagt der ehemalige Chef der SPD und der Linkspartei. Und ist sich sicher: Die USA haben Nordstream zerstört. Von Milena Preradovic. Der Beitrag “Ami, it’s time to go” erschien zuerst auf reitschuster.de….

Neue Videos: Ernst Wolff, PRERADOVIC mit Oskar Lafontaine, Alcyon Pleyaden Extra 34, Marc Friedrich
21.11.2022, 17:37 Uhr. uncut-news.ch – https: – Bei G20 offiziell bestätigt | Wie Theorie zur Wahrheit wird! „Die USA haben Nordstream zerstört“ – Punkt.PRERADOVIC mit Oskar Lafontaine Alcyon Pleyaden Extra 34: Lula DS, pädophil, LGBT, Millionär, Zerstörung Kinder, Bolsonaro, Proteste Direkt zum Video: Übersterblichkeit steigt massiv an – was ist der Grund? BlackRock: 2…

Herr Nouripour, was sagen Sie eigentlich zur Sprengung der deutschen Nord Stream Pipeline durch die USA?
21.11.2022, 17:06 Uhr. Blauer Bote Magazin – Wissenschaft statt Propaganda – blauerbote.com – „Bundeswirtschaftsminister Robert Habeck reiste im März nach Katar, um eine Energiepartnerschaft zu vereinbaren. Es bestehen zudem enge wirtschaftliche Verflechtungen mit deutschen Unternehmen. Man könnte den Deutschen angesichts der lauten Kritik an der WM in Katar Doppelmoral vorwerfen. Wie sehen Sie das? Das sind doch zwei Paar Schuhe. Wir…

Zum US-Militärschlag gegen die deutsche Nord-Stream-Pipeline
19.11.2022, 18:51 Uhr. Blauer Bote Magazin – Wissenschaft statt Propaganda – blauerbote.com – Natürlich würden die USA oder einer ihrer Verbündeten in ihrem Auftrag „es“ jederzeit tun. Sie haben es schon so oft getan. Auch wenn die Bundesregierung diesen Angriff auf Deutschland begrüßt und ihn deckt – oder sogar direkt beteiligt ist – ist er dennoch völkerrechtswidrig, denn nicht die Bundesregierung „ist“…

tagesschau.de: Nord-Stream-Explosionen waren Sabotage
18.11.2022, 19:50 Uhr. Transition News – https: – – Empfehlungen / Gas, Schweden, Russland, Energie…

Nord Stream und die chinesische Bombe
14.11.2022, 15:04 Uhr. Blauer Bote Magazin – Wissenschaft statt Propaganda – blauerbote.com – Selbstverständlich würden sie es tun. Die eigene Infrastruktur sprengen. Die eigenen Leute angreifen. Die eigene Bevölkerung terrorisieren. Bei Nord Stream war es nicht das erste Mal und es wird auch nicht das letzte Mal sein. Hier aktuelle Meldungen zum Thema Nord-Stream-Pipeline-Sprengung sowie im Anschluss daran der letzte Beitrag der chinesischen…

Vor der Explosion von Nord Stream waren zwei unidentifizierte Schiffe vor Ort
13.11.2022, 11:01 Uhr. Anti-Spiegel – https: – Das US-Portal wire.com hat einen langen Artikel veröffentlicht, in dem es berichtet, dass Experten mithilfe von Satellitenbildern festgestellt haben, dass sich kurz vor den Explosionen der Nord-Stream-Pipelines zwei nicht identifizierte Schiffe mit abgeschalteten Transpondern in der Nähe aufgehalten haben. Kurz darauf erfolgten die Explosion. Der…

Nord Stream und die Zeitenwende
08.11.2022, 12:23 Uhr. Rubikon Magazin – https: – Nord Stream und die Zeitenwende…

Nord-Stream-Update – Scholz warnt vor „weltweiter Renaissance fossiler Energien“ – „Staatswohl hat Vorrang vor Aufklärung“
08.11.2022, 11:02 Uhr. Blauer Bote Magazin – Wissenschaft statt Propaganda – blauerbote.com – Selected Articles: Video: Who Blew Up Nord Stream Pipelines? “The Russians Did It”08.11.2022, 09:36 Uhr. Global Research – https: – Video: Who Blew Up Nord Stream Pipelines? “The Russians Did It” By Matt Orfalea and Prof Michel Chossudovsky, November 08, 2022 Carefully documented video below on “Who Blew Up Nord…

Selected Articles: Video: Who Blew Up Nord Stream Pipelines? “The Russians Did It”
08.11.2022, 09:36 Uhr. Global Research – https: – Video: Who Blew Up Nord Stream Pipelines? “The Russians Did It” By Matt Orfalea and Prof Michel Chossudovsky, November 08, 2022 Carefully documented video below on “Who Blew Up Nord Stream Pipeline”. And who was that foreign state actor? … The post Selected Articles: Video: Who Blew Up Nord Stream Pipelines? “The Russians Did…

Video: Who Blew Up Nord Stream Pipelines? “The Russians Did It”
08.11.2022, 04:05 Uhr. Global Research – https: – All Global Research articles can be read in 51 languages by activating the Translate Website button below the author’s name. To receive Global Research’s Daily Newsletter (selected articles), click here. Follow us on Instagram and Twitter and subscribe to … The post Video: Who Blew Up Nord Stream Pipelines? “The Russians Did It”…

NATO-Akte: Briten halfen der Ukraine russische Flotte anzugreifen und haben Nord Stream gesprengt?
07.11.2022, 12:49 Uhr. apolut.net – https: – Zu den Themen diskutieren: Thomas Röper (Freier Journalist für den Blog „Anti-Spiegel“ in Russland) Dirk Pohlmann (Chefredakteur Free21, Dokumentarfilmer) Sergey Filbert (Moderator und Betreiber des YouTube-Kanals Druschba FM) Die Gesprächsrunde wurde am 5.11.2022 aufgezeichnet. +++ Der Beitrag erschien zuerst am 7.11.2022 auf dem YouTube-Kanal…

Wie in Russland über die Rolle Großbritanniens bei Nord Stream berichtet wird
07.11.2022, 07:31 Uhr. uncut-news.ch – https: – In Russland ist man sich sicher, dass Großbritannien sowohl an der Sprengung der Nord Streams, als auch an dem Angriff auf Sewastopol beteiligt war. Hier zeige ich, wie in Russland darüber berichtet wird. Über die russischen Vorwürfe, Großbritannien sei sowohl an der Sprengung der Nord-Stream-Pipelines, als auch an dem Drohnenangriff auf die russische…

RGM-84 Harpoon – „Zuverlässigen Quellen zufolge wurde ein amerikanischer Torpedo an der Explosionsstelle der Nord-Stream-Gaspipeline gefunden“
06.11.2022, 21:18 Uhr. Blauer Bote Magazin – Wissenschaft statt Propaganda – blauerbote.com – Exclusive: U.S. Torpedo Appeared at Explosion Site of the Nord Stream „Zuverlässigen Quellen zufolge wurde ein amerikanischer Torpedo an der Explosionsstelle der Nord Stream-Gaspipeline gefunden. Es handelte sich um den Torpedo-Typ, den der Lenkwaffenzerstörer USS Paul Ignatius (DDG 117) der Arleigh-Burke-Klasse mit sich führte – eine…

Nord-Stream-Update – US-Angriff mit Großbritannien?
06.11.2022, 12:24 Uhr. Blauer Bote Magazin – Wissenschaft statt Propaganda – blauerbote.com – Russland wirft London Angriffe vor und will Beweise veröffentlichen06.11.2022, 10:43 Uhr. Anti-Spiegel – https: – Russland hat Großbritannien vorgeworfen, an der Sprengung von Nord Stream und dem Angriff auf die russische Schwarzmeerflotte beteiligt zu sein. In der Tat mehren sich dafür auch andere Hinweise, die nicht von Russland kommen…

Russland wirft London Angriffe vor und will Beweise veröffentlichen
06.11.2022, 10:43 Uhr. Anti-Spiegel – https: – Russland hat Großbritannien vorgeworfen, an der Sprengung von Nord Stream und dem Angriff auf die russische Schwarzmeerflotte beteiligt zu sein. In der Tat mehren sich dafür auch andere Hinweise, die nicht von Russland kommen. Russland fordert nun Aufklärung von Großbritannien und hat angekündigt, die vorliegenden Informationen zu veröffentlichen…

Russia To Present Evidence UK Special Forces Behind Attack On Black Sea Fleet Off Crimea
05.11.2022, 14:47 Uhr. GreatGameIndia – https: – Russia has previously charged British special operators of assisting in the planning of the September sabotage attack on the Nord Stream gas pipelines beneath the Baltic. And now, Russia is set to present evidence of UK special forces being behind the attack on the Black Sea fleet off Crimea. The post Russia To Present Evidence UK Special Forces Behind…

Die Oktober-Überraschung
05.11.2022, 06:01 Uhr. Free21.org – https: – Die offizielle russische Reaktion auf den Nord-Stream-Angriff besteht darin, ihn als US-Militäroperation zu identifizieren und auf eine Untersuchung zu warten, die Beweise liefert. Das bedeutet: abwarten, verzögern. Keine Vergeltung. „Wie werden wir reagieren?“, sagte Maria Zakharova, die Sprecherin des russischen Außenministeriums, am Donnerstag…

Ob Nancy Faeser im Fall der toten Radfahrerin genauso durchgreift wie bei Nord Stream oder der toten Demonstrantin in Berlin?
04.11.2022, 11:24 Uhr. Blauer Bote Magazin – Wissenschaft statt Propaganda – blauerbote.com – In Berlin ist eine Radfahrerin gestorben, die bei einem Unfall von einem Betonmischer eingeklemmt worden war. Ein zur Rettung benötigtes schweres Räumfahrzeug konnte nicht rechtzeitig an den Unfallort kommen, da der Weg von sogenannten „Klima-Klebern“ der „Letzten Generation“ – eine Art Straßen-Sturmtrupp der Politik…

Kim Dotcom: Staatsgeheimnisse sind nur für die gewöhnlichen Menschen geheim, nicht aber für Nationen, die in den globalen Cyberkrieg verwickelt sind
04.11.2022, 07:36 Uhr. uncut-news.ch – https: – Die Staatsoberhäupter der 20 führenden Spionagenationen wissen, wer die Nord Stream-Pipeline in die Luft gejagt hat. Lassen Sie mich die Realität der hyper-transparenten Spionagewelt erklären, in der wir heute leben. „Streng geheim“ bedeutet für die weltweit besten Spionageagenturen nichts. Geheimhaltung ist dazu da, die Bürger im…

Exclusive: U.S. Torpedo Appeared at Explosion Site of the Nord Stream
03.11.2022, 16:28 Uhr. Global Research – https: – All Global Research articles can be read in 51 languages by activating the Translate Website button below the author’s name. To receive Global Research’s Daily Newsletter (selected articles), click here. Follow us on Instagram and Twitter and subscribe to … The post Exclusive: U.S. Torpedo Appeared at Explosion Site of the Nord Stream…

U.S. Act of War against the European Union: President Biden Ordered the Terror Attack against Nord Stream. High Treason against the People of Europe
03.11.2022, 10:33 Uhr. Global Research – https: – All Global Research articles can be read in 51 languages by activating the “Translate Website” drop down menu on the top banner of our home page (Desktop version), or on the Translate This Article above. To receive Global Research’s … The post U.S. Act of War against the European Union: President Biden Ordered the Terror Attack against…

Nord-Stream-Update – Bundesregierung und Britische Marine
01.11.2022, 17:33 Uhr. Blauer Bote Magazin – Wissenschaft statt Propaganda – blauerbote.com – Russia Accuses British Navy Of Nord Stream “Terrorist Attack”01.11.2022, 14:32 Uhr. GreatGameIndia – https: – The Swedish Armed Forces have been investigating the scene for the entire past week and have confirmed that powerful blasts were to blame for the extensive damage to the Nord Stream pipelines. This confirms the…

Russia Accuses British Navy Of Nord Stream “Terrorist Attack”
01.11.2022, 14:32 Uhr. GreatGameIndia – https: – The Swedish Armed Forces have been investigating the scene for the entire past week and have confirmed that powerful blasts were to blame for the extensive damage to the Nord Stream pipelines. This confirms the terrorist attack and now Russia is accusing the British Navy of carrying it out. The post Russia Accuses British Navy Of Nord Stream “Terrorist…

Overton: Die Anschläge auf die Nordstream-Pipelines – wer ist dafür verantwortlich zu machen?
01.11.2022, 09:13 Uhr. Transition News – https: – – Empfehlungen…

Video: Who Blew Up Nord Stream Pipelines? A Mystery!
31.10.2022, 23:51 Uhr. Global Research – https: – All Global Research articles can be read in 51 languages by activating the Translate Website button below the author’s name. To receive Global Research’s Daily Newsletter (selected articles), click here. Follow us on Instagram and Twitter and subscribe to … The post Video: Who Blew Up Nord Stream Pipelines? A Mystery! appeared first…

Kim Dotcom: So erfuhren die Russen von Briten als Täter der Nord Stream Sprengung
31.10.2022, 12:28 Uhr. tkp.at – https: – Kim Dotcom ist die legendäre Figur aus Neuseeland, dessen Auslieferung die USA wegen angeblicher Urheberrechtsverletzungen mit seinem Megaupload-Cloudspeicher verlangt haben. Ich habe auf dem früheren Portal telekom-presse.at (tkp ist davon die Abkürzung) einige Male berichtet. Damals hatte sich die US-Justiz zur Erfüllungsgehilfin der US-Contentindustrie…

Nord-Stream-Update – „Staatswohl hat Vorrang vor Aufklärung“
31.10.2022, 09:21 Uhr. Blauer Bote Magazin – Wissenschaft statt Propaganda – blauerbote.com – How the Media Quarantined Evidence on Nord Stream Sabotage31.10.2022, 08:16 Uhr. Global Research – https: – All Global Research articles can be read in 51 languages by activating the Translate Website button below the author’s name. To receive Global Research’s Daily Newsletter (selected articles), click here. Follow…

How the Media Quarantined Evidence on Nord Stream Sabotage
31.10.2022, 08:16 Uhr. Global Research – https: – All Global Research articles can be read in 51 languages by activating the Translate Website button below the author’s name. To receive Global Research’s Daily Newsletter (selected articles), click here. Follow us on Instagram and Twitter and subscribe to … The post How the Media Quarantined Evidence on Nord Stream Sabotage appeared…

Die Nord-Stream-2-Pipeline
31.10.2022, 07:01 Uhr. ZG Blog – zeitgeistlos.de – »Es ist sehr wahrscheinlich, dass der Sabotageakt mit starken Explosionen negative Auswirkungen auf beide Pipelinestränge hatte und die grundsätzliche technische Verfügbarkeit somit aktuell nicht mehr gegeben ist, heißt es in einer Antwort der Bundesregierung.« – tagesschau.de vom 27. Oktober 2022 … Weiterlesen →…

Unterwasseranschläge zum Schaden Deutschlands
29.10.2022, 06:01 Uhr. Free21.org – https: – Am Mittwoch, dem 28. September 2022, brachte die „Frankfurter Allgemeine Zeitung“ auf ihrer Titelseite ein großflächiges Bild von der Ostsee, auf dem ein runder, weißer Fleck auf dem dunkelblauen Wasser zu sehen war. Darunter war zu lesen: „Gas sprudelt an die Oberfläche: Leck in der Pipeline von Nord Stream 2“ Am linken Rand des Bilds …

3. JT #84: Bombenspiel
27.10.2022, 21:52 Uhr. Mathias Broeckers – https: – Eine schmutzige Bombe soll den Krieg in der Ukraine eskalieren – behaupten die Russen. Bilden die sich das nur ein oder steckt mehr dahinter? Außerdem: Das Kanzleramt will China erlauben, sich in Hamburg einzukaufen, aber das eigentliche Thema ist nicht der Hafen. Und nach der Sprengung von Nord Stream 2 läuft zwar keine richtige Ermittlung,……


Offizielle Fotos der 9/11-Anschlagsorte Pentagon und Shanksville

Bei der Betrachtung der berühmten „Terroranschläge des 11. September 2001 in den USA“ stehen meist die Anschlagstellen in New York im Mittelpunkt, insbesondere die beiden eingestürzten großen World-Trade-Center-Türme WTC1 und WTC2. Der ebenfalls eingestürzte Hochhausturm WTC7, der definitiv nicht Ziel eines Flugzeug-Selbstmordangriffs war, erfährt hingegen kaum Beachtung.

Ebenso wenig im Rampenlicht stehen in der Regel die beiden „kleinen Terroranschlagsorte“ in Shanksville und Arlington, die jeweils auch Absturzstelle eines entführten Passagierflugzeuges sein sollen. In beiden Fällen war das Flugzeug jeweils eine Boeing 757. Während der Tatort Shanksville in Pennsylvania mehr oder weniger zufällig an diese Rolle kam, war das „Terrorziel“ in Arlington gezielt ausgewählt: Das US-Verteidigungsministerium, auch „Pentagon“ genannt – nach dem Pentagon-Gebäude in Arlington.

Eine Analyse der Anschlagsorte in Arlington und Shanksville beziehungsweise der dort von US-Behördenmitarbeitern direkt nach den „Terroranschlägen“ gemachten Fotos lohnt sich. Denn natürlich bricht mit dem Zusammenbrechen der amtlichen Story zu einem einzigen Tatort auch die komplette Geschichte von den angeblichen radikalislamistischen Terroranschlägen in den USA durch Osama bin Laden und seine neunzehn mit Teppichmessern bewaffnete Arabern zusammen.

Hier im folgenden US-Behörden-Fotos vom Anschlagstag 11. September 2001 aus Shanksville und Arlington, gemacht nicht von „Verschwörern“, sondern von kleinen Mitarbeitern vor Ort, die „nur ihren Job erledigt“ haben. Bei einigen sind zur Verdeutlichung rote Quadrate etc. eingezeichnet. Alle Originalfotos beziehungsweise Originalquellen dazu sind verlinkt. Alle Fotos stehen öffentlich im Internet.

Bild 1: Amtliche Boeing-757-Einschlagstelle in Arlington am Pentagon am 11. September 2001. Foto oben links: Direkt nach dem Einschlag, Bild der US Navy. Foto mittig links: Kurz vor dem Zusammensturz mit offizieller „quadratischer“ Einschlagstelle in der unteren Mitte des Bildes, Bild des US Marine Corps, Wikimedia. Foto unten links: Nach dem Zusammenbruch, Bild der US Air Force, Wikipedia. Rechts: Auszug aus einem PDF der Bundeswehr mit einem Beitrag zum „Anschlag auf das Pentagon“ am 11. September 2001.

Bild 2: Offizielle Einschlagstelle der Boeing 757-223 im Pentagon sowie eine Boeing 757-223 der American Airlines, Fotos von US Marine Corps, Wikipedia.

Bild 3: Offizielle Einschlagstelle der Boeing 757-223 im Pentagon sowie eine Boeing 757-223 der American Airlines, Fotos aus WikimediaWikipedia.

Bild 4: Offizielles angebliches Einschlagloch der Boeing 757. Links: Foto der US Navy. Rechts: Foto des US Marine Corps, Wikimedia.

Bild 5: Links das Pentagon nach dem „Einschlag“ mit intaktem Erdgeschoss, Bild der US Navy. Rechts: später sind die Außenmauern weg, Bild der US Navy.

Bild 6: Offizielles Boeing-757-Einschlagsloch sowie Erdgeschoss, Fotos (von links nach rechts) von US Marine Corps/WikimediaUS Navy und nochmal US Navy.

Bild 7: Links die offizielle „Boeing-Einschlagstelle“, Foto des US Marine Corps, Wikimedia. Rechts: Offizieller schräger Einschlag ins Pentagon, amtliche Grafik der US Navy, abrufbar unter history.navy.mil.

Bild 8: Links angebliche Einschlagsstelle eines Fahrwerks im mittleren inneren Ring, Foto des US-Verteidigungsministeriums, Wikimedia. Rechts der offizielle Einschlagswinkel, amtliche Grafik der US Navy.

Bild 9: Vier Bilder der 9/11-Pentagon-Einschlagstelle. Links oben: kurz nach dem „Boeing-Einschlag“. Andere Fotos: kurz vor dem Zusammenbruch des Gebäudeteils. Fotos von US NavyUS Marine CorpsWikimedia.

Bild 10: Impact-Stelle am Pentagon kurz nach dem „Flugzeugeinschlag“ und später vor dem Zusammenbruch. Fotos von US Navy und nochmal US Navy.

Bild 11: Offizielle Einschlagstelle der Boeing 757-223 im Pentagon sowie eine Boeing 757-223 der American Airlines, Fotos von US NavyWikipedia.

Bild 12: Offizielle Einschlagstelle der Boeing 757-223 im Pentagon sowie eine Boeing 757-223 der American Airlines, Fotos von US NavyWikipedia.

Bild 13: Erdgeschoss unter und rechts der offiziellen Boeing-757-Einschlagstelle im Pentagon. Links: Kurz nach dem vermeintlichen Einschlag ist das Erdgeschoss noch vorhanden. Fotos von US Navy und nochmal US Navy.

Bild 14: Während die Fenster um die angebliche Boeing-757-Einschlagstelle unversehrt sind, sind die Fenster an der angeblichen Einschlagstelle eines Flugzeug-Fahrwerks im inneren Ring C „irgendwie“ zerbrochen worden. Fotos von WikimediaWikipedia, Verteidigungsministerium der USA – „Hole Truth: Flight 77’s landing gear punched a 12-ft. hole into the Pentagon’s Ring C.“.

Bild 15: Links ein Foto der US Navy, mit der offiziellen Boeing-Einschlagstelle direkt nach dem „Anschlag“. Kein Scherz: Rechts ein Screenshot mit einem Foto der US Navy mit dem Titel „Die ersten Feuerwehrteams beginnen mit den Löscharbeiten in den Minuten nach dem Anschlag, 11. September 2001“.

Bild 16: Die Taktik der Rettungskräfte beinhaltete offenbar die Entfernung tragender Mauern und den Einsatz von Holzpaletten. Links ein Foto der US Navy, mit der offiziellen Boeing-Einschlagstelle direkt nach dem „Anschlag“. Rechts ein Foto des US Military Health System.

Bild 17: Amtliche Boeing-757-Einschlagsstelle in Arlington am Pentagon bei 9/11. Foto oben rechts: Direkt nach dem Einschlag, US Navy. Foto links: Kurz vor dem Zusammensturz mit offizieller „quadratischer“ Einschlagstelle in der unteren Mitte des Bildes, US Marine Corps, Wikimedia. Foto unten rechts: Nach dem Zusammenbruch, US Air Force, Wikipedia.

Bild 18: Rechts die offizielle schräge Anflugroute des Verkehrsflugzeuges auf das Pentagon, Grafik der US Navy. Links ein Foto der US Army mit „geradem Schadensbild“, Aufnahme nach dem Einbrechen der Obergeschosse.

Bild 19: Offizielle Absturzstelle von Flug 93 auf dem Feld in Shanksville, Pennsylvania, 11. September 2001. Der links in Großaufnahme zu sehende Krater ist im rechten unteren Foto genau in der Mitte zu sehen. Die beiden Fotos wurden von US-Behörden hergestellt und sind Public Domain, beispielsweise bei Wikipedia und Wikimedia erhältlich. Rechts oben das „Shanksville-Flugzeug“ drei Tage vor seiner Entführung, Wikipedia.

Bild 20: Offizielle Absturzstelle von Flug 93 auf dem Feld in Shanksville, Pennsylvania, 11. September 2001. Wikipedia und Wikimedia.

Bild 21: Offizielle Absturzstelle von Flug 93 (eine Boeing 757) auf dem Feld in Shanksville, Pennsylvania, 11. September 2001. Wikipedia.

Bild 22: Offizielle Absturzstelle von Flug 93 auf dem Feld in Shanksville, Pennsylvania, 11. September 2001. Wikimedia.

Bild 23: Offizieller Einschlagskrater von Flug 93 im deutschsprachigen Wikipedia-Artikel „Terroranschläge am 11. September 2001„. Links direkt im Text, rechts das Artikel-zugehörige Großbild bei Klick auf das kleine „Textbild“. Bildbeschriftung: „10:03 Uhr: UA93 stürzt bei Shanksville ab. Aufnahme vom Einschlagskrater. US Government. Public domain“.

Der Elfte September

Die False-Flag-Attacken vom 11.9.2001 und ihre Auswirkungen offenbaren den blanken Rassismus der Westlichen Wertegemeinschaft und ihren Kampf gegen Wissenschaft und Aufklärung.

Vor zwanzig Jahren zog sich die US-Regierung einen Freifahrtschein für einen „War on Terror“, mit dem der Erdball vor allem im globalen Süden überzogen wurde und der Millionen Ausländern den Tod brachte. An der Heimatfront und bei den Verbündeten wurden die eigenen Bürger zurechtgestutzt und „eingedost“. Dass die offizielle Story zu den vorgeblich von der Terrororganisation Al Qaida unter ihrem Führer Osama bin Laden durchgeführten Anschlägen in den USA nicht nur voll von Widersprüchen, sondern für jeden Menschen, der einigermaßen bei Verstand und guten Willens ist, klar als „Bullshit“ zu identifizieren ist, aber trotzdem durchgesetzt wird, scheint für viele der selbsternannten Herren der Menschheit eher ein befriedigender Potenzbeweis als ein Problem zu sein. Wer in der Coronakrise sagt „aber, aber, das würden die doch niemals tun“, der sieht bei 9/11 deutlich, dass sie es tun und schon getan haben, wenn auch auf etwas niedrigerem Level.

Gleich eingangs soll hier an einem einfachen und für jeden klar verständlichen Beispiel gezeigt werden, dass die offizielle Geschichte des Elften Septembers falsch ist und US-Regierung und Co Täter sind und keine Opfer. Wer nach Ansicht der Bilder der offiziellen Einschlagstelle am Pentagon, dem Sitz des US-Verteidigungsministeriums, immer noch behauptet, bei Kritikern der amtlichen 9/11-Theorie handele es sich um Spinner oder Antisemiten, und jegliche Diskussion ablehnt, der spuckt auf die Grundlagen der Physik und den Menschenverstand und will vielleicht einen Kampf gewinnen, in dem er sich wähnt, aber sicher keine Aufklärung der wirklichen Umstände betreiben.

Bild 1: Amtliche Boeing-757-Einschlagsstelle in Arlington am Pentagon bei 9/11. Foto oben rechts: Direkt nach dem Einschlag, US Navy (1). Foto links: Kurz vor dem Zusammensturz mit offizieller „quadratischer“ Einschlagstelle in der unteren Mitte des Bildes, US Marine Corps, Wikimedia (2). Foto unten rechts: Nach dem Zusammenbruch, US Air Force, Wikipedia (3).

Schon ein Blick auf die vermeintliche Pentagon-Einschlagstelle in Arlington zeigt, dass hier kein Passagierflugzeug von ungefähr 50 Meter Länge mit einer Flügelspannweite von 38 Metern und einem Gewicht von über 100000 Kilogramm plus zehntausender Liter Treibstoff – der Flug sollte nach Los Angeles gehen – ein kleines Mauerloch verursacht hat, und das, ohne die umliegenden Fenster zu beschädigen. Auf dem US-Navy-History-Foto oben rechts, das die Situation direkt nach dem Einschlag zeigt, sieht das Verhalten der umstehenden Personen eigentlich eher nach einer Übung samt Evakuierung als nach katastrophalem Ernstfall aus. Den offiziellen Angaben zufolge sind hier gerade alleine am Boden, ohne Flugzeuginsassen, 125 Menschen gestorben – oder liegen zu diesem Zeitpunkt noch im Sterben (4). Das Foto links zeigt die Situation später, kurz vor dem Gebäude-Zusammensturz, samt offizieller „quadratischer“ Einschlagstelle. Das Foto unten rechts zeigt diese Stelle später während der Bergungsarbeiten, nach dem Zusammenbruch dieses Gebäudeteils.

Bild 2: Rechts die offizielle schräge Anflugroute des Verkehrsflugzeuges auf das Pentagon, Grafik der US Navy (5). Links ein Foto der US Army mit „geradem Schadensbild“, Aufnahme nach dem Einbrechen der Obergeschosse (6).

Da im Bereich der angeblichen Katastrophenstelle der frontale Anflug auf das Pentagon-Gebäude für ein Flugzeug im Tiefflug so gar nicht möglich – da verbaut – ist, musste man sich hinsichtlich der vermeintlichen Anflugroute des Flugzeuges etwas einfallen lassen und hat die hier oben im Bild rechts zu sehende Grafik veröffentlicht, welche die offizielle Anflugroute der Boeing-757 zeigt: Schräg ins Gemäuer, gerade noch so an dem Generator vorbei, der neben den Baucontainern steht. Dass dieser „schräge Vogel“ dem Vergleich mit der Realität nicht standhält, zeigen die oben gezeigten Fotos der offiziellen Impact-Stelle. Man beachte auch die beeindruckende Stabilität der Mauern links, die dem angeblich schräg in sie rein einschlagenden Flugzeug genauso gut standhielten wie die Fenster über der „Einschlagstelle der Boeing 757“.

Wissenschaft, Aber-Aber-Ritual und Antisemitismus

Beliebt als „Angriffswerkzeug“ nach dem Verweis auf solche Bilder ist die Unterstellung, man würde behaupten, in die beiden WTC-Türme in New York seien ja gar keine Flugzeuge eingeschlagen. „Aber, aber, ich habe doch mit eigenen Augen die Flugzeuge in die Türme einschlagen sehen!“ heißt es dann, einhergehend mit der stillschweigenden, aber druckvollen Behauptung, der Kritiker sei ein Spinner. Nur ist es eben so, dass bei den Anschlagsstellen in New York im Wesentlichen die Art und Weise des Zusammenbruchs der Zwillingstürme Stunden nach den Einschlägen kritisiert wird, der nach Art einer geplanten Sprengung ablief, und darüber hinaus der Zusammenbruch beziehungsweise die Sprengung eines weiteren Turms neben diesen beiden Türmen, WTC-7, in den kein Flugzeug flog. Die wirkliche wissenschaftliche Antwort auf diese Unterstellung, die ja de facto ein Ablenkungsmanöver ist, und sei es aus Verzweiflung, weil man die Realität nicht wahrhaben will oder geschockt ist, ist aber, dass die Ereignisse in New York hier gar nicht relevant sind. Bricht eine Säule der offiziellen Theorie zusammen, bricht alles zusammen. Das nennt man Wissenschaft. Es wird doch nicht eine Lüge dadurch geheilt, dass man an einer anderen Stelle – vermeintlich – Recht hat. So funktioniert das nicht. Man kann nicht einfach so lange ein „Aber-Aber-Ritual“ durchführen, bis das Gegenüber – vermeintlich – keine Antwort mehr hat, indem es beispielsweise an der Forderung gescheitert ist, alle Schuhgrößen der damaligen Hausmeister der WTC-Türme auswendig und korrekt Personen zugeordnet aufzusagen, nur um dann selbst halb im Wahn zu brüllen „Ha, ich hatte doch recht! Stimmt ja gar nicht! Stimmt ja gar nicht!“. Was hier spaßeshalber etwas übertrieben dargestellt wurde, findet vom Grundprinzip her ständig statt, hat aber mit Wissenschaft und Aufklärung nichts zu tun.

Eine beliebte Waffe gegen Wissenschaftler und andere Zweifler ist neben dem Propagandaclaim „irrer Verschwörungstheoretiker“ und dem Aber-Aber-Ritual der – haltlose – Antisemitismusvorwurf. Selbstverständlich gibt es keinen wissenschaftlichen Zusammenhang zwischen der Forderung nach einer naturwissenschaftlich-physikalischen Betrachtung von Ereignissen und Hass auf Juden. Das ist doch völlig irrwitzig. Vor dem zwanzigsten Jahrestag der 9/11-Terrorangriffe kann man allerdings in den Medien Folgendes finden:

Bild 3: Links der Tagesspiegel (7), rechts der NDR zu 9/11 und Antisemitismus (8).

Der Berliner Tagesspiegel schreibt am 10.9.2021:

„Antisemitismus und Fake News: Wie sich Verschwörungstheorien nach 9/11 unter Berliner Jugendlichen ausbreiteten. Immer wenn etwas Böses passiert, wird nach Sündenböcken und alternativen Fakten gesucht. Woher Verschwörungsmythen nach 9/11 kamen und wer sie weiterverbreitet hat.“

Beim ARD-Sender NDR heißt es zur Sendung ZAPP vom 8.9.2021:

„9/11 und Verschwörungstheorien: 20 Jahre danach. 20 Jahre nach dem 11. September 2001 werden noch immer krude Verschwörungsmythen über die Attentate verbreitet: in sozialen Medien, Dokus oder im Deutschrap. Stets werden darin Schuldige ausgemacht – und zwar keine islamistischen Terroristen. Mal steckt angeblich die US-Regierung dahinter, mal eine ‚jüdische Weltverschwörung‘. Was macht das mit den Hinterbliebenen? Welche Folgen hat das für Jüdinnen und Juden, die mit diesen oft antisemitischen Verschwörungsnarrativen angefeindet werden? Und welche Verantwortung tragen die Plattformbetreiber, die solche Inhalte zur Verfügung stellen?“

Der Antisemitismusvorwurf gegen Kritiker offizieller Narrative wird mittlerweile im Prinzip beliebig eingesetzt, wie nicht nur bei 9/11, sondern vor auch in der Coronakrise und bei anderen Themen zu beobachten ist. Dabei macht die Antisemitismusverleumdung nicht einmal vor Juden halt (9). So musste sich beispielsweise die kürzlich verstorbene Auschwitz-Überlebende und überzeugte Antifaschistin Esther Bejarano von nicht-jüdischem deutschen „Jungvolk“ als Antisemitin beschimpfen lassen, weil sie dessen Ansichten nicht teilte, und Moshe Zuckermann, Professor für Geschichte und Philosophie sowie jüdischer Sohn von Holocaust-Überlebenden, erleidet das gleiche Schicksal, wie er in einem Interview berichtet (10, 11). Bei den verleumdenden Personen handelt es sich im Wesentlichen um die gleichen Pseudolinken, die sich heute in der Coronakrise für Machteliten-Politik prügeln wollen, und keine tatsächlichen Linken, sondern eher dauerbeleidigte Wohlstandskinder darstellen. Ein wesentlicher Teil dieser lautstarken Gruppen sind sich selbst als „Antideutsche“ betitelnde Personen, die eben auch, zusätzlich zu einigen Journalisten, Politikern etc., beim Thema 9/11 aktiv sind. Der Schutz der westlichen Machteliten ist für sie gleichbedeutend mit „Kampf gegen Antisemitismus“. Einen ungefähren Einblick in diese „Denkweise“ erlaubt ein Auszug aus einem Interview bei Neues Deutschland vom November 2014 mit der in antideutschen Kreisen äußerst beliebten Band „Antilopengang“, die von der Band Die Toten Hosen – gefallene Punkrock-Helden mit Hang zur Merkel-Verehrung – stark gefördert wird (12, 13):

„Danger Dan: Also Blockupy fand‘ ich schon besonders dumm. Diese Idee es gäbe irgendwie 99% von Unterdrückten, die von einem Prozent Reicher unterdrückt werden – ein besseres Beispiel für verkürzte Kapitalismuskritik gibt’s eigentlich gar nicht. Da würde auch die NPD unterschreiben und mitmachen.

Koljah: Das ist ja auch schon fast Antisemitismus. Da ist ja schon der Aufruf zum Pogrom impliziert.

Danger Dan: Das das überhaupt noch geht, dass Linke sich auf so einen Unsinn einigen können, hat mich krass verwundert. Da bin ich dann doch sehr froh über Rechtsstaatlichkeit, über Polizisten, die diese Leute dann im Zaum halten. Und ich würde auch tatsächlich, wenn diese Leute sich erheben und das umsetzen wollen, was da zwischen den Zeilen angekündigt wird, dieses reiche eine Prozent – wer auch immer das sein soll – wenn die die jetzt lynchen würden, würde ich auch auf der Seite der Polizei gegen sie kämpfen. Mit Waffengewalt.

Koljah: Ich muss sagen: mich hat’s überhaupt nicht verwundert. Sondern das steht in der Tradition einer Linken, die in Deutschland spätestens seit 68 antisemitisch durchsetzt ist. Das passt dazu. Diese ganzen Proteste, die so tun als könne man nur »das Finanzkapital« kritisieren, die ein Bild von »guter Kapitalismus gegen schlechter Kapitalismus« zeichnen, bieten genau den Anknüpfungspunkt für Antisemitismus. […]

Danger Dan: Da wo solche abstrakten Probleme auf irgendwelche Minderheiten oder am Ende noch die Juden projiziert werden, bin ich aus dem Spiel raus und hab keine Lust darauf. Ich bin dann sehr skeptisch und bei mir gehen die Alarmglocken an. Und im Fall von Antisemitismus sind Juden die, die als Juden angegriffen werden. Das hat nichts mit Religion zu tun.“

Bizarre Claims

Eingangs wurde bereits aufgezeigt, dass die amtliche Verschwörungstheorie von Osama bin Laden, der aus einer Höhle in Afghanistan heraus neunzehn mit Teppichmessern bewaffnete Islamisten dirigierte, die in den USA vier Flugzeuge kaperten und damit die 9/11-Anschläge begingen, nicht haltbar ist. Auch das „Loch von Shanksville“ zeigt dies noch einmal deutlich auf. Hier war wie in Arlington am Pentagon ebenfalls kein Flugzeug am Werk:

Bild 4: Offizielle Absturzstelle von Flug 93 auf dem Feld in Shanksville, Pennsylvania, 11. September 2001. Der links in Großaufnahme zu sehende Krater ist im rechten unteren Foto genau in der Mitte zu sehen. Die beiden Fotos wurden von US-Behörden hergestellt und sind Public Domain, beispielsweise bei Wikipedia und Wikimedia erhältlich (14, 15, 16). Rechts oben das „Shanksville-Flugzeug“ drei Tage vor seiner Entführung, Wikipedia (17).

Wie jeder sehen kann, zeigen die beiden offiziellen Fotos der 9/11-Shanksville-„Absturzstelle“, dass dort kein großes Verkehrsflugzeug abgestürzt ist. Man sieht einen kleinen Einschlagskrater von vielleicht gerade Mal fünf Metern Durchmesser. Man beachte die Fahrzeuge und Bäume im rechten unteren Bild und vergleiche das mit dem kleinen Krater in der Mitte dieses Fotos. Man beachte die beiden Menschen mit den weißen Hosen, die neben dem links in Großaufnahme zu sehenden Krater stehen. Dieses Mini-Loch kann niemals die Einschlagstelle einer Passagiermaschine sein.

Dass an der ganzen 9/11-Story etwas faul ist, hätte man sich allerdings auch ohne die gezeigten Bilder bereits denken können. Die Kurzfassung:

1. USA gründet Al Qaida („Mudschaheddin“) – sagt selbst Hillary Clinton (18).

2. „Al Qaida“ begeht laut USA 9/11-Anschläge (3000 Tote) in 2001 in USA (19).

3. USA und Al Qaida überfallen gemeinsam Syrien (seit 2011), Libyen, Yemen…(20)

Die Figur „Osama bin Laden“ taucht nicht erst mit den Anschlägen in den USA auf der Bildfläche auf. Osama bin Laden war vorher ganz offiziell „unser Mann in Afghanistan“, wo er als Führer der Qaida für die US-Amerikaner gegen die sowjetischen und afghanischen Truppen kämpfte (21). Es gibt da dieses berühmte Foto von Bin Laden in einem nicht weniger berühmten Artikel der britischen Zeitung Independent aus dem Jahre 1993, der den amtlichen Terroristenchef als unseren Helden im Kampf gegen die Sowjetunion in Afghanistan feiert.

Bild 5: Foto des Independent-Artikels zu Bin Laden (22).

Der Independent hat mittlerweile das Bin-Laden-Foto aus der Onlineversion des Artikels entfernt („Photograph omitted“). In dem Artikel mit der Überschrift „Anti-Soviet warrior puts his army on the road to peace: The Saudi businessman who recruited mujahedin now uses them for large-scale building projects in Sudan. Robert Fisk met him in Almatig“ von 1993 geht es um die – angebliche – Zeit der Figur Bin Laden nach dem Kampf seiner Mudschaheddin-Jihadisten – später als „Al Qaida“ tituliert – gegen die sowjetische Armee in Afghanistan: Er hielt sich danach laut Independent-Artikel im Sudan auf und soll sich dort im Straßenbau verdient gemacht haben (22).

Als 2016 im Syrienkrieg der Kampf der syrischen Truppen gegen die die prowestlichen Besatzer von Aleppo anstand, konnte man einen Sprecher des US-Verteidigungsministeriums folgendes sagen hören (23):

“That said, it’s primarily al-Nusra who holds Aleppo”

Al Nusra ist der in Syrien tätige Arm der Al Qaida und das bestreitet weder Freund noch Feind. Mittlerweile wurde Al Nusra umbenannt etc.. Die Qaida – „Rebellen“ genannt – hielt also nach Angaben des US-Militärs Aleppo beziehungsweise Ost-Aleppo, vom Westen unterstützt und mit Waffen beliefert. Bekannt war das schon lange vor der hier zitierten Aussage und blitzte auch schon Mal bei TagesschauSpiegel und Co durch (24, 25, 26).

al_kaida_christoph_sydow_spiegel

Bild 6: Screenshot aus Spiegel Online, hoffen auf Al-Qaida-Truppennachschub (26, 27).

An diesem Punkt stellt sich doch jedem, der klar bei Verstand ist, die Frage, wie es denn bitte sein kann, dass man als US-Regierung beziehungsweise Westliche Wertegemeinschaft auch nur in Erwägung zieht, mit Al Qaida zu kämpfen beziehungsweise diese einzusetzen, geschweige denn, dies tatsächlich wenige Jahre nach den vorgeblichen Jahrhundertanschlägen der Al Qaida in den USA auch zu tun. 2011 begann der als „syrischer Bürgerkrieg“ getarnte Angriff auf Syrien, unter anderem mit ausländischen Kämpfern von Al Qaida, und quasi parallel dazu hat man ganz offiziell die Figur Osama bin Laden entsorgt, der den amtlichen Angaben zufolge am 2. Mai 2011 in Pakistan nicht etwa festgenommen, sondern getötet wurde, und dessen Leiche man leider direkt entsorgt hat… Wikipedia schreibt zu Letzterem (28):

„Bin Ladens Identität wurde nach Angaben der US-Regierung mit einer DNA-Analyse festgestellt und sein Leichnam noch am 2. Mai 2011 an geheimer Stelle von Bord des US-Flugzeugträgers USS Carl Vinson im Arabischen Meer bestattet.“

Ein neues blutiges Jahrhundert, im Notstand

Der Nationale Notstand in den USA, der aufgrund der „9/11-Al-Qaida-Angriffe“ erlassen wurde, wird seit 20 Jahren jedes Jahr vom jeweiligen US-Präsidenten verlängert. Bush, Obama, Trump und jetzt Biden am 9. September 2021 (29): Sie alle verlängerten immer wieder ihre Notstandsbefugnisse in einer „Notice on the Continuation of the National Emergency with Respect to Certain Terrorist Attacks“.

Der „War on Terror“ seit 2001 hat außerhalb des Westens Millionen Menschenleben gekostet, die bei den Führern und Aktivisten der Westlichen Wertegemeinschaft keine Bedeutung zu haben scheinen. Der blanke Rassismus. Dazu hat man noch ein paar hundert Unschuldige eingefangen, die selbstverständlich mit den Terrorattacken von 9/11 nichts zu tun haben können, wie wir bereits eingangs mit der Aufdeckung des False-Flag-Charakters der Anschläge gesehen haben, und hat sie zum demonstrativen Durchfoltern in Guantanamo oder zur heimlichen Folter an noch finstereren Orten eingekerkert. Einige sitzen da heute noch. Alles offenbar „scheißegal“. Der blanke Rassismus. Der Gefangene Ahmed Rabbani hat Anfang 2021 einen Brief an US-Präsident Biden geschrieben, aus dem hier ein kleiner Auszug zitiert werden soll (30, 31):

„Als ich 2002 in Karachi gekidnappt wurde und an die CIA für ein Kopfgeld verkauft wurde mit einer falschen Story, dass ich ein Terrorist namens Hassan Gul sei. Meine Frau und ich hatten gerade die gute Auskunft bekommen, dass sie schwanger war. Ein paar Monate später gebar sie meinen Sohn Jawad. Mir wurde niemals erlaubt, mein eigenes Kind zu sehen. Präsident Biden ist ein Mann, der von der Bedeutung der Familie spricht. Ich frage mich, ob er sich vorstellen kann, was es bedeutet, niemals den eigenen Sohn berührt zu haben. Meiner wird bald 18 Jahre alt sein und ich bin nicht dort gewesen, um ihm zu helfen oder ihn zu leiten. (…)

Der Bericht des Geheimdienstausschusses des Senats über die CIA-Folter wurde ‚unter seiner Aufsicht‘ 2014 abgeschlossen, wie man sagt. Es ist ein Report, in dem ich vorkomme. Darin steht, dass ich 540 Tage gefoltert wurde in einem ‚Dunkel-Gefängnis‘ in Afghanistan ‚ohne Erlaubnis‘ – ob das besser oder schlechter ist, kann ich nicht entscheiden

Ich kann bestätigen, dass die Folter stattfand, obwohl ich die Tage und Nächte nicht selbst zählen konnte: die Tage und Nächte flossen zu einem Block zusammen, als ich in einer finsteren Grube an einer Stange aufgehängt war und mir die Arme unter Qualen aus den Schultern auskugelten.

Ich zweifle, ob Präsident Biden verstehen kann, was diese Folter bedeutet; eine Frau im Nebenraum schreien zu hören und einem gesagt wird, dass es deine Frau ist, und dass, wenn ich nicht tue, was sie sagen, sie vergewaltigt oder getötet wird.“

Türme und noch ein Einsturz

Jetzt sind wir am Ende des Artikels angelangt und der Einsturz der drei Türme in New York, nachdem zwei davon von Flugzeugen getroffen wurden, der immer so im Fokus steht, wurde gar nicht behandelt. Man muss das auch nicht, um nachzuweisen, dass die Geschichte der US-Regierung zu 9/11 nicht stimmt, wie wir gleich eingangs gesehen haben. Für Interessierte gibt es allerdings genug Material, das aufzeigt, dass die Türme nur gesprengt worden sein können und nicht einfach so zusammengebrochen sind. Glücklicherweise haben sich auch einige aufrechte Physiker und Ingenieure des Themas angenommen und die Sache überprüft und durchgerechnet. Im Prinzip kann aber jeder Amateur schon beim Anschauen der Fall-Videos von WTC-1, WTC-2 und WTC-7 leicht erkennen, dass das jeweils einer Abbruchsprengung eines Hochhauses verdammt ähnlich sieht und dass die Wolkenkratzer fast im freien Fall, ohne Widerstand, zu Boden rauschen, was eben nur durch eine Sprengung möglich ist, wie auch immer diese technisch durchgeführt wurde. Die völlig ausgebrannten Hochhäuser in London und Peking, die im Gegensatz zu dem mit einem Stockwerksbrand „ausgestatteten“ WTC-7 einfach stehengeblieben sind, dürfte wohl auch jeder kennen…(32, 33)

Die offizielle „Theorie“ zu 9/11 ist längst eingestürzt, man muss die Nachricht davon nur noch verbreiten (34-52). Wer dahingehend noch zaudert, dem sei zur Entscheidungsfindung höflichst ein kleines Gedankenspiel empfohlen: Stellen Sie sich vor, Sie würden Ahmed Rabbani bei einem Besuch in Guantanamo Bay gegenüberstehen und sollten ihm erklären, dass sie keine Texte zur Aufklärung von 9/11 weiterverbreiten wollten, weil Sie Angst hatten, dass Sie bei Verbreitung solcher Aussagen vielleicht irgendwann einmal eine Facebook-Sperre hätten bekommen können.

Links

(1) https://www.history.navy.mil/content/history/nhhc/research/library/online-reading-room/title-list-alphabetically/p/pentagon-9-11-footnotes/_jcr_content/body/image_14.img.jpg/1438613592644.jpg
(2) https://commons.wikimedia.org/wiki/File:DM-SD-02-03880.JPEG
(3) https://en.wikipedia.org/wiki/File:Aerial_view_of_the_Pentagon_during_rescue_operations_post-September_11_attack.JPEG
(4) https://en.wikipedia.org/wiki/Victims_of_Terrorist_Attack_on_the_Pentagon_Memorial
(5) https://www.history.navy.mil/content/dam/nhhc/research/library/online-reading-room/pentagon911/pentagon_911-8.jpg
(6) http://blauerbote.com/wp-content/uploads/2021/09/army_mil_pentagon.jpg
(7) https://plus.tagesspiegel.de/berlin/antisemitismus-und-fake-news-wie-sich-verschwoerungstheorien-nach-911-unter-berliner-jugendlichen-ausbreiteten-243077.html
(8) https://www.ndr.de/fernsehen/sendungen/zapp/9-11-und-Verschwoerungstheorien-20-Jahre-danach,gefaehrlichemyth100.html
(9) https://projektkritischeaufklaerung.de/de/konferenz-in-berlin-am-10-februar-2018/
(10) http://blauerbote.com/2021/08/11/dokumentarfilm-zeit-der-verleumder-mit-moshe-zuckermann-rolf-becker-jackie-walker-ali-abunimah-moshe-machover-judith-bernstein-esther-bejarano-u-a/
(11) https://odysee.com/@Punkt.PRERADOVIC:f/Zuckermann:4
(12) http://blauerbote.com/2021/08/02/die-machteliten-die-toten-afrikaner-und-die-absicherung-der-herren-durch-beleidigte-wohlstandskinder/
(13) https://www.nd-aktuell.de/artikel/951837.punk-hat-viele-widerspruechliche-inhalte.html
(14) https://fr.m.wikipedia.org/wiki/Fichier:Flight_93_Crater.jpg
(15) http://blauerbote.com/wp-content/uploads/2019/11/flight_93_crash_crater_911_shanksville_pennsylvania_september11_united_airlines_usa_2001_terror.png
(16) https://commons.wikimedia.org/wiki/File:Flight93Crash.jpg
(17) https://en.wikipedia.org/wiki/United_Airlines_Flight_93#/media/File:N591UA.jpg
(18) http://blauerbote.com/2018/07/27/noam-chomsky-hillary-clinton-we-created-al-qaeda-isis/
(19) http://blauerbote.com/2019/09/20/was-ist-911/
(20) http://blauerbote.com/2018/09/05/laut-usa-und-tagesschau-handelt-es-sich-bei-den-rebellen-in-syrien-um-al-qaida/
(21) http://blauerbote.com/2018/10/08/zbigniew-brzezinski-afghanistan-al-qaida-und-osama-bin-laden/
(22) http://www.independent.co.uk/news/world/anti-soviet-warrior-puts-his-army-on-the-road-to-peace-the-saudi-businessman-who-recruited-mujahedin-1465715.html
(23) http://www.defense.gov/News/Transcripts/Transcript-View/Article/739157/department-of-defense-press-briefing-by-col-warren-via-teleconference-from-bagh
(24) http://blauerbote.com/2017/03/18/syrien-ost-aleppo-wurde-von-al-qaida-beherrscht/
(25) http://blauerbote.com/2018/09/05/laut-usa-und-tagesschau-handelt-es-sich-bei-den-rebellen-in-syrien-um-al-qaida/
(26) http://blauerbote.com/2016/08/02/der-spiegel-feuert-al-kaida-an-die-islamisten-sind-aleppos-letzte-hoffnung/
(27) https://www.spiegel.de/politik/ausland/syrien-die-islamisten-sind-aleppos-letzte-hoffnung-a-1105806.html
(28) https://de.wikipedia.org/wiki/Osama_bin_Laden
(29) https://www.whitehouse.gov/briefing-room/presidential-actions/2021/09/09/notice-on-the-continuation-of-the-national-emergency-with-respect-to-certain-terrorist-attacks/
(30) https://einarschlereth.blogspot.com/2021/02/ich-bin-ein-gefangener-in-guantanamo.html
(31) http://blauerbote.com/2021/02/05/ich-bin-ein-gefangener-in-guantanamo-bay-und-ich-habe-eine-botschaft-fuer-praesident-biden/
(32) http://blauerbote.com/2017/06/14/hochhausbrand-in-london-vs-wtc7-einsturz-bei-911/
(33) https://www.rubikon.news/artikel/20-jahre-terrorluge
(34) http://blauerbote.com/2021/09/09/118-augenzeugen-zu-9-11-das-zeugnis-der-feuerwehrleute-zu-den-explosionen-in-den-zwillingstuermen/
(35) https://www.rubikon.news/artikel/der-verklarte-tag
(36) https://www.rubikon.news/artikel/die-jahrhundertluge
(37) http://blauerbote.com/2016/09/05/physiker-fachblatt-zu-911-world-trade-center-einsturz-durch-kontrollierte-sprengung/
(38) https://www.europhysicsnews.org/articles/epn/pdf/2016/04/epn2016474p21.pdf
(39) https://www.rubikon.news/artikel/die-sprengung
(40) https://kenfm.de/akademische-naivitaet-und-der-11-september/
(41) https://www.amazon.de/Stigmatisierung-statt-Aufkl%C3%A4rung-%C2%BBVerschw%C3%B6rungstheorie%C2%AB-kontrafaktischen/dp/3862420019
(42) https://www.rubikon.news/artikel/selektive-wahrheitssuche
(43) https://www.rubikon.news/artikel/selektive-wahrheitssuche-2
(44) https://www.rubikon.news/artikel/der-pentagon-fake
(45) https://www.rubikon.news/artikel/der-scheinheilige-2
(46) https://www.radio-utopie.de/2016/09/10/15-jahre-terrorkrieg-und-11-september-wie-alles-begann/
(47) https://www.broeckers.com/911-2/
(48) https://www.rubikon.news/artikel/bilanz-eines-jahrhundertverbrechens
(49) http://antikrieg.com/aktuell/2019_08_08_dasverbrechen.htm
(50) http://blauerbote.com/2021/04/08/der-911-verschwoerungswahn/
(51) https://www.broeckers.com/2021/08/06/mythos-9-11-alles-klar-herr-kommissar/
(52) https://www.buchkomplizen.de/buecher-mehr/mythos-9-11.html

Spendenkonto für die Gerichtsverfahren gegen den Stern/Bertelsmann-Konzern