Gesellschaft Medien Politik Wirtschaft Wissenschaft

Ganz normaler Terror

NSU-Attentate, Verfassungsschutz, Anis-Amri-Islamischer-Staat-Breitscheidplatz-Berlin-Anschlag, Al-Qaida-9/11-Attacken, Osama Bin Laden und Krieg gegen den Terror, Hanau-Amoklauf mit dreizehn rechtsextremen hessischen SEK-Beamten im Einsatz etc.. Die Westliche Wertegemeinschaft hat in Deutschland und weltweit Einiges zu bieten… Die Opfer dieser Taten sollten nicht vergessen werden.


Die Unterwerfung der Welt

Die Machteliten arbeiteten schon „vor Corona“ mit Schockereignissen und Realitätsfälschung.

Endlich keine Widerworte mehr, endlich alles unter Kontrolle, endlich alles in den eigenen Händen? Das von den grauen Eminenzen der westlichen Machteliten ausgerufene „Neue Amerikanische Jahrhundert“ begann mit einem „kreativen Paukenschlag“. Jetzt soll mit der Coronakrise ein noch größerer Knall den Planeten, die Wirtschaft, die Bevölkerung, die Körper unter Kontrolle bringen und „endlich“ den Deckel auf den Topf machen. Mit der absoluten Kontrolle soll auch das Glaubwürdigkeitsproblem der Herrschenden beseitigt werden, das sich durch ihre ständig platzenden Propagandalügen ergibt. Es ist wichtig, darauf hinzuweisen, dass die Coronakrise letztlich nur die Fortsetzung des Krieges gegen die Menschheit mit einem anderen Mittel ist und nicht plötzlich und unerwartet über uns hereingebrochen ist. Die Enttarnung der mittlerweile quasi offen von US-Multimilliardären befehligten Machteliten durch die Betrachtung des „ersten Paukenschlags“ 9/11 trägt dazu bei, das Corona-Regime zum Einsturz zu bringen, denn bei den Corona-Tätern und den 9/11-Tätern handelt es sich um die gleiche Bande.

Der Nationale Notstand in den USA, der aufgrund der „9/11-Al-Qaida-Angriffe“ vom 11. September 2001 erlassen wurde, wird seit 20 Jahren jedes Jahr vom jeweiligen US-Präsidenten verlängert. Bush, Obama, Trump und zuletzt Biden am 9. September 2021: Sie alle haben immer wieder die Notstandsbefugnisse in einer „Notice on the Continuation of the National Emergency with Respect to Certain Terrorist Attacks“ verlängert (1).

Der mit der Begründung von angeblich durch radikalislamistische Al-Qaida-Terroristen begangenen „Anschläge des 11. September 2001“ ausgerufene „War on Terror“ hat außerhalb des Westens Millionen Menschenleben gekostet, die bei den Führern und Aktivisten der Westlichen Wertegemeinschaft keine Bedeutung zu haben scheinen.

Der Notstand, die Überwachung und der „War on Terror“ basieren auf bereits auf den ersten Blick erkennbaren bizarren antiwissenschaftlichen Lügen. Selbstverständlich wissen die Soldaten der Bundeswehr beispielsweise, wie es aussieht und was passiert, wenn ein großes Verkehrsflugzeug à la Boeing-757 in eine Hauswand brettert. Wenn also in den Heften und Broschüren des deutschen Militärs „Informationen“ erscheinen, die jeden Betrachter angesichts der gezeigten „Inkompetenz“ vor Lachen vom Stuhl fallen lassen, dann ist das politisch so gewollt. Nicht das Lachen, sondern das Verkaufen bizarrer Falschinformationen als „die reine Wahrheit“.

Bild 1: Amtliche Boeing-757-Einschlagstelle in Arlington am Pentagon am 11. September 2001. Foto oben links: Direkt nach dem Einschlag, Bild der US Navy (2). Foto mittig links: Kurz vor dem Zusammensturz mit offizieller „quadratischer“ Einschlagstelle in der unteren Mitte des Bildes, Bild des US Marine Corps, Wikimedia (3). Foto unten links: Nach dem Zusammenbruch, Bild der US Air Force, Wikipedia (4). Rechts: Auszug aus einem PDF der Bundeswehr mit einem Beitrag zum „Anschlag auf das Pentagon“ am 11. September 2001 (5).

Die Betrachtung der vermeintlichen Pentagon-Boeing-757- Einschlagstelle im US-Verteidigungsministerium in Arlington – Bild oben – zeigt klar auf, dass hier kein – von „Islamisten“ entführtes – großes Passagierflugzeug ein kleines Mauerloch verursacht hat, und das, ohne die umliegenden Fenster zu beschädigen. Auf dem US-Navy-Foto oben links, welches die Situation direkt nach dem Einschlag zeigt, sieht das Verhalten der umstehenden Personen nicht nach einem Katastrophenfall aus. Den offiziellen Angaben zufolge sind hier gerade alleine am Boden 125 Menschen gestorben – oder liegen zu diesem Zeitpunkt noch im Sterben (6). Das Foto mittig links zeigt die Situation später, kurz vor dem Gebäude-Zusammensturz, samt offizieller „quadratischer“ Einschlagstelle. Das Foto unten links zeigt diese Stelle später während der Aufräumarbeiten, nach dem forcierten Zusammenbruch dieses Gebäudeteils. Man beachte auch, dass das Erdgeschoss direkt nach dem Einschlag noch vorhanden ist… Rechts im Bild ein PDF-Dokument der Bundeswehr zu 9/11 mit einer ganz eigenen Vorstellungen von Physik und Realität. Textauszug (5):

„Kurz nach 9:37 Uhr flog AmericanAirlines-Flug 77 in das größte Bürogebäude der Welt: das Pentagon. Genau gegenüber der Bundeshauptstadt Washington auf der anderen Seite des Flusses Potomac beendete der Absturz einen eineinviertelstündigen Flug, der am Dulles International Airport bei Washington begonnen hatte. Die Zerstörung, die der Aufschlag der 100 Tonnen schweren Boeing bei 460 Knoten beziehungsweise 235 Metern pro Sekunde mit sich brachte, war verheerend. Die Innenfläche des Pentagon beträgt insgesamt 610 000 Quadratmeter. Der Aufschlag zerstörte sofort etwa vier Prozent dieser Fläche und tötete 125 Personen im Pentagon sowie 59 unschuldige Passagiere an Bord des Flugzeugs. Die circa 18 Tonnen Kerosin an Bord verursachten zusätzlich einen sich schnell ausbreitenden Brand. Dieser gefährdete die etwa 20 000 sich zu dieser Zeit im Gebäude befindenden Menschen sowie die zahlreichen Einsatzkräfte, die innerhalb der nächsten 32 Stunden vor Ort eintrafen. Ein Zufall rettete viele Leben: Die Büros von 4000 Mitarbeitern in der Aufschlagzone waren bereits für begonnen Renovierungsarbeiten im Pentagon geräumt worden.“

Bild 2: Offizielle Einschlagstelle der Boeing 757-223 im Pentagon sowie eine Boeing 757-223 der American Airlines, Fotos von US Marine Corps, Wikipedia (7, 8).

Bild 3: Offizielle Einschlagstelle der Boeing 757-223 im Pentagon sowie eine Boeing 757-223 der American Airlines, Fotos aus WikimediaWikipedia (7, 9).

Bild 4: Offizielles angebliches Einschlagloch der Boeing 757. Links: Foto der US Navy (2). Rechts: Foto des US Marine Corps, Wikimedia (9).

Bild 5: Links das Pentagon nach dem „Einschlag“ mit intaktem Erdgeschoss, Bild der US Navy (2). Rechts: später sind die Außenmauern weg, Bild der US Navy (10).

Bild 6: Offizielles Boeing-757-Einschlagsloch sowie Erdgeschoss, Fotos (von links nach rechts) von US Marine Corps/WikimediaUS Navy und nochmal US Navy (9, 2, 10).

Bild 7: Links die offizielle „Boeing-Einschlagstelle“, Foto des US Marine Corps, Wikimedia (9). Rechts: Offizieller schräger Einschlag ins Pentagon, amtliche Grafik der US Navy, abrufbar unter history.navy.mil (11).

Bild 8: Links angebliche Einschlagsstelle eines Fahrwerks im mittleren inneren Ring, Foto des US-Verteidigungsministeriums, Wikimedia (12). Rechts der offizielle Einschlagswinkel, amtliche Grafik der US Navy (11).

Bild 9: Vier Bilder der 9/11-Pentagon-Einschlagstelle. Links oben: kurz nach dem „Boeing-Einschlag“. Andere Fotos: kurz vor dem Zusammenbruch des Gebäudeteils. Fotos von US NavyUS Marine CorpsWikimedia (2, 7, 13, 3).

Bild 10: Impact-Stelle am Pentagon kurz nach dem „Flugzeugeinschlag“ und später vor dem Zusammenbruch. Fotos von US Navy und nochmal US Navy (2, 14).

Bild 11: Offizielle Einschlagstelle der Boeing 757-223 im Pentagon sowie eine Boeing 757-223 der American Airlines, Fotos von US NavyWikipedia (14, 8).

Bild 12: Offizielle Einschlagstelle der Boeing 757-223 im Pentagon sowie eine Boeing 757-223 der American Airlines, Fotos von US NavyWikipedia (2, 8).

Bild 13: Erdgeschoss unter und rechts der offiziellen Boeing-757-Einschlagstelle im Pentagon. Links: Kurz nach dem vermeintlichen Einschlag ist das Erdgeschoss noch vorhanden. Fotos von US Navy und nochmal US Navy (2, 14).

Bild 14: Während die Fenster um die angebliche Boeing-757-Einschlagstelle unversehrt sind, sind die Fenster an der angeblichen Einschlagstelle eines Flugzeug-Fahrwerks im inneren Ring C „irgendwie“ zerbrochen worden. Fotos von WikimediaWikipedia, Verteidigungsministerium der USA – „Hole Truth: Flight 77’s landing gear punched a 12-ft. hole into the Pentagon’s Ring C.“ (3, 12).

Bild 15: Links ein Foto der US Navy, mit der offiziellen Boeing-Einschlagstelle direkt nach dem „Anschlag“ (2). Kein Scherz: Rechts ein Screenshot mit einem Foto der US Navy mit dem Titel „Die ersten Feuerwehrteams beginnen mit den Löscharbeiten in den Minuten nach dem Anschlag, 11. September 2001“ (15).

Bild 16: Die Taktik der Rettungskräfte beinhaltete offenbar die Entfernung tragender Mauern und den Einsatz von Holzpaletten. Links ein Foto der US Navy, mit der offiziellen Boeing-Einschlagstelle direkt nach dem „Anschlag“ (2). Rechts ein Foto des US Military Health System (16).

Die Propaganda behauptet, wer nicht an die offizielle Story zum 11. September 2001 glaubt, sei ein irrer Verschwörungstheoretiker und Antisemit. Das gleiche Vorgehen erleben wir jetzt auch bei der Coronakrise. Beim Anblick der Originalbilder zu 9/11 wird klar, wo hier die Wahnsinnigen zu verorten sind. Mit der Coronakrise soll die totale Kontrolle und Unterwerfung dauerhaft zementiert werden. Je früher man sich dagegen wehrt, desto besser.

Links

(1) https://www.whitehouse.gov/briefing-room/presidential-actions/2021/09/09/notice-on-the-continuation-of-the-national-emergency-with-respect-to-certain-terrorist-attacks/
(2) https://www.history.navy.mil/content/history/nhhc/research/library/online-reading-room/title-list-alphabetically/p/pentagon-9-11-footnotes/_jcr_content/body/image_14.img.jpg
(3) https://commons.wikimedia.org/wiki/File:DM-SD-02-03880.JPEG
(4) https://en.wikipedia.org/wiki/File:Aerial_view_of_the_Pentagon_during_rescue_operations_post-September_11_attack.JPEG
(5) https://www.bundeswehr.de/resource/blob/5201394/30202483f7963933354acac25648cf78/zmg-2021-h2-data.pdf
(6) https://en.wikipedia.org/wiki/Victims_of_Terrorist_Attack_on_the_Pentagon_Memorial
(7) https://publicintelligence.net/wp-content/uploads/2011/09/DM-SD-02-03889.jpeg
(8) https://de.wikipedia.org/wiki/Boeing_757#/media/Datei:N606AA-2008-09-13-YVR_crop.jpg
(9) https://upload.wikimedia.org/wikipedia/commons/d/db/DM-SD-02-03880.JPEG
(10) https://www.history.navy.mil/content/history/nhhc/research/library/online-reading-room/title-list-alphabetically/p/pentagon-9-11-footnotes/_jcr_content/body/image_15.img.jpg
(11) https://www.history.navy.mil/content/dam/nhhc/research/library/online-reading-room/pentagon911/pentagon_911-8.jpg
(12) https://commons.wikimedia.org/wiki/File:911-pentagon-hole-l.jpg
(13) https://commons.wikimedia.org/wiki/File:DM-SD-02-03886.JPEG
(14) https://www.history.navy.mil/content/dam/nhhc/research/library/online-reading-room/pentagon911/pentagon_911-23.jpg
(15) https://www.history.navy.mil/research/archives/digital-exhibits-highlights/photo-galleries-9-11/pentagon-attack/image-04.html
(16) https://health.mil/News/Gallery/Photos/2016/09/11/Pentagon-Ruins


Der Merkel-Breitscheidplatz-Skandal

Der offizielle Geschichte des Terroranschlags auf dem Breitscheidplatz in Berlin ist vor dem Untersuchungsausschuss des Bundestages in sich zusammengebrochen.

Den Terrorangriff mit Hilfe eines Lastwagens auf den Breitscheidplatz-Weihnachtsmarkt am 19. Dezember 2016 soll den offiziellen Angaben der Bundesregierung zufolge der Tunesier Anis Amri im Auftrag des IS -„Islamischer Staat“ – begangen haben (1). Doch im Breitscheidplatz-Untersuchungsausschuss des Bundestages mussten Behördenvertreter zugeben, dass keine DNA-Spuren oder Fingerabdrücke Amris im LKW-Führerhaus oder auf seiner Brieftasche oder seinem Smartphone gefunden wurden. Ebenso wurden auf dem Smartphone Fotos des Platzes gefunden, die zeitlich weit nach der Tat aufgenommen wurden, als der Tatort bereits weiträumig von den Behörden abgeriegelt war. Anis Amri kann also unmöglich der Täter gewesen sein.

Bild: Berichterstattung im Magazin Telepolis. „Keine Fingerabdrücke und DNA-Spuren von Amri im Tat-LKW“, „Die offizielle Anschlagsgeschichte wird immer bizarrer“, „Anis Amri: „Ich habe mit dieser Sache nichts zu tun. Helft mir!!!““ (2-4)

Im Breitscheidplatz-Untersuchungsausschuss des deutschen Bundestages wurde bereits Anfang März 2020 bekannt, dass im bei der Tat benutzten und angeblich von Anis Amri gefahrenen LKW – laut Bundesanwaltschaft wurde der eigentliche Lastwagenfahrer vor dem Attentat auf dem Parkplatz des LKWs auf dem Beifahrersitz erschossen – keine DNA-Spuren oder gar Fingerabdrücke von Amri gefunden wurden, nicht einmal auf seiner Brieftasche und seinem Handy (2, 5)! Das ist natürlich wissenschaftlich und technisch nicht möglich. Thomas Moser schrieb dazu in Telepolis:

„Der Untersuchungsausschuss im Bundestag entdeckt massive Hinweise auf Manipulationen bei den Anschlagsermittlungen – Landeskriminalamt eng mit islamistischer Szene verwoben (…)

Am und im LKW haben die Mordermittler Fingerabrücke gesichert und DNA-Spuren aufgenommen. Wie viele das letztlich waren, kann Thomas Bordasch nicht sagen, weil alle Befunde zur Auswertung an den Staatsschutz des Landeskriminalamtes gingen. Die einzige Rückmeldung, die von dort kam, lautete: Außen am LKW an der Fahrerseite seien zwei Fingerabdrücke festgestellt worden, die zum Tatverdächtigen Amri führen. Weitere Fundstellen werden von den Auswertern nicht genannt. Das heißt: Im LKW gab es offensichtlich keinerlei Fingerprints und DNA Amris. Nicht einmal auf seinem eigenen Portemonnaie und Handy, die im Cockpit lagen.

Einen abschließenden Bericht über den daktyloskopischen Befund kennt Ermittler Bordasch nicht. Eigentlich müsste es ihn geben. Und auch über die letztendliche Auswertung aller Spuren nach Abgabe ans LKA Berlin weiß er nichts. Ein Abschlussbericht hat ihn nie erreicht.“

Thomas Moser, der die Aufklärungsbemühungen von Politik und Behörden zum Breitscheidplatz-Attentat journalistisch begleitet, informierte später die Öffentlichkeit über die eingangs erwähnten Fotos, die nicht zur offiziellen Anschlagsgeschichte passen und dem Bundestagsuntersuchungsausschuss zum Breitscheidplatz-Attentat offenbar erst im Mai 2020 bekannt wurden (3):

„Der Untersuchungsausschuss (UA) des Bundestags hat entdeckt, dass sich auf dem HTC-Handy des angeblichen Attentäters Amri, das in einem Karosserieloch des LKW lag, zwei Fotos befinden, die nach dem Anschlag gemacht wurden. Sie zeigen die Unfallstelle und das zerstörte Fahrzeug. Wer die Fotos gemacht hat oder wie sie auf das Smartphone gelangt sind, kann auch das BKA bisher nicht schlüssig erklären. (…)

Wo die Abgeordneten graben, stoßen sie auf Details, die nicht mit der offiziellen Anschlagsgeschichte zusammenpassen, wie sie beispielsweise ein BKA-Ermittler im Bundestag erneut formuliert hat: Die Tat sei die eines Einzeltäters gewesen. Amri habe sich des LKW allein bemächtigt und damit den Anschlag begangen. Die Möglichkeit habe sich erst am 19. Dezember ergeben. Als Amri am Abend des 18.Dezember mit Ben Ammar zusammensaß, habe er noch nicht gewusst, dass er am nächsten Tag die Tat begehen werde. So der Erste Kriminalhauptkommissar (EKHK) A.M. jetzt als Zeuge im Ausschuss.

Als ihm die zwei Fotos aus dem HTC-Handy vorgelegt werden, muss er passen: Er habe sie noch nie gesehen, er habe keine Erklärung dafür.

Die Fotos müssen einige Zeit nach dem Anschlagszeitpunkt um 20:02 Uhr entstanden sein. Der Tatort ist bereits abgesperrt, Polizisten und Rettungskräfte sind zu sehen. Dass Amri, der den LKW gefahren haben soll, sie selber gemacht hat, ergibt für den BKA-Mann keinen Sinn. Dann wäre der Täter ja noch stundenlang vor Ort geblieben. Zumal er gegen 21:30 Uhr in seiner Unterkunft gewesen sein soll, um seine Sachen zu holen, ehe er flüchtete.

Dass die Bilder von einem Mittäter gemacht wurden, bezweifelt der BKA-Ermittler ebenfalls. Schließlich würde das die offizielle Einzeltäter-Theorie zum Einsturz bringen.“

Direkt nach dem Attentat wurde ein flüchtender Mann durch einen Augenzeugen des Anschlags verfolgt (6). Die Polizei nahm daraufhin den Pakistaner Naved B. fest, verkündete aber kurz darauf, dass dieser nicht der Täter gewesen sei (7). Es ist jedoch ungeklärt, ob der Mann, den der Augenzeuge verfolgt hat, tatsächlich besagter Naved B. gewesen sein kann, denn der Augenzeuge hatte den Täter bei seiner Flucht aus den Augen verloren (8). Anis Amri schlenderte derweil laut Überwachungskameraaufnahmen gemütlich aus der U-Bahn kommend aus dem Bahnhof Zoo hinaus – und nicht hinein – und wusste nichts von seinem „Glück“, einen Anschlag begangen zu haben (9).

vb’s weblog schreibt in dem Artikel „Die Personalie Hans-Georg Maaßen“ zum Fall Amri und der Verstrickung der Behörden unter Hinweis auf entsprechende Presseberichte von taz, Spiegel, Welt, Telepolis und anderen (10):

„Der immer noch sogenannte ‚Verfassungsschutz‘, also der deutsche Inlandsgeheimdienst, ist seit Jahrzehnten bekannt dafür, Neonazinetzwerke zu finanzieren. Die Morde des NSU sind derart exemplarisch für die Machenschaften, in die dieser Geheimdienst bis dahin verstrickt ist, dass er einen Agenten während mindestens eines der Morde vor Ort hatte – Morde, bei denen schließlich nicht nur eine Polizistin unter bis heute ungeklärten Umständen ums Leben gekommen ist, sondern die auch nachweislich nicht so abgelaufen sein können, wie von den ‚Sicherheitsbehörden‘ behauptet (11, 12) .

Das ist jedoch nicht das einzige, was Geheimdienstchef Maaßen belastet. Denn wer einen genaueren Blick auf den Fall Amri wirft, dem stehen die Haare zu Berge. Und zwar nicht nur deshalb, weil, wie Ströbele es ausdrückte, jemand eine schützende Hand über Amri gehalten hatte, damit der seinen Anschlag trotz Mitwissens praktisch aller relevanter ‚Sicherheitsbehörden‘ durchführen konnte (13).

Der ‚Verfassungsschutz‘ hatte Amri tatsächlich einen Chauffeur gestellt (14). Das muss man sich auf der Zunge zergehen lassen: einen Chauffeur bekommt jemand, der so wichtig ist, dass er einzeln transportiert werden muss, der jedoch nicht selbst fahren kann oder soll. Man vergleiche das mit dem Tatwerkzeug auf dem Breitscheidplatz, und dem, was Amri dort vorgeworfen wird! Amri ist angeblich per Zug geflüchtet – und erschossen wurde er ganz in der Nähe des Ortes in Italien, wo der LKW losgefahren war, den er angeblich zufällig wo ganz anders in Europa gekapert hatte (15).

Bei solchen Geschichten (die in der Reihe der Geheimdienstgeschichten keinesfalls Exoten darstellen) stellen sich einem die Nackenhaare auf. Die Personalie Maaßen ist jedoch längst nicht mehr zu halten, falls noch irgendwelche Regeln gelten. Denn Maaßen hatte die Akte Amri persönlich auf dem Schreibtisch – vor dem Anschlag (16).“

Verfassungsschutz-Präsident Maaßen ließ später auch Medien-Berichte zu einem Behördenspitzel im Amri-Umfeld unterdrücken. Der Berliner Tagesspiegel schrieb dazu (17):

„Hans-Georg Maaßen beauftragte Anwälte, um Drohbriefe an die Presse zu schicken – eine unübliche Maßnahme für eine Bundesbehörde. Er nennt es ‚Korrekturbitte‘. (…) Wie das BfV dem Tagesspiegel auf Anfrage mitteilt, habe die Behörde nach Berichten über ‚vermeintliche V-Leute im Umfeld des Attentäters vom Breitscheidplatz‘ Anfang des Jahres 2017 ‚anwaltliche Korrekturbitten‘ versenden lassen. Den Bitten sei entsprochen worden.“

Anis Amri selbst hat sich Aussagen von Bekannten zufolge nach dem bekanntgewordenen Attentat von diesem distanziert. Das Bundeskriminalamt wusste von dem Sachverhalt. Die Distanzierung Amris passt zu den veröffentlichten Videos des aus der U-Bahn kommenden Amri und natürlich dazu, dass nicht einmal DNA-Spuren in der LKW-Fahrerkabine oder an Geldbeutel oder Handy gefunden wurden. Thomas Moser schreibt zu der Nachricht Amris nach dem Attentat, die den Bundesbehörden vorliegt (18):

Der Tunesier Anis Amri, nach offiziellen Angaben der Fahrer des Tat-LKW vom Breitscheidplatz in Berlin, soll gegenüber Bekannten und Freunden in einer Whats-App-Nachricht bestritten haben, an dem Anschlag beteiligt gewesen zu sein. Das geht aus den Ermittlungsunterlagen des Bundeskriminalamtes (BKA) hervor.

Bemerkenswert ist das vor allem deshalb, weil Amri nicht nur seit vier Jahren als der alleinige Attentäter gehandelt wird, sondern sich laut offizieller Auslegung außerdem auch zu der Tat, bei der zwölf Menschen starben, bekannt haben soll. (…)

Der Aktenfund widerspricht dieser Bewertung. Der Sachverhalt konkret: Mohamed A., der Bruder von Khaled A., mit dem sich Amri bis zum Anschlagstag ein Zimmer teilte, erhielt auf seinem Mobiltelefon ein Posting von Anis Amri, versehen mit einem Passbild von ihm und einem Text mit folgendem Wortlaut:

‚Leute, ich kann mich nicht öffentlich zeigen, ich habe mit dieser Sache nichts zu tun. Ich würde so was nie im Leben machen. Alles gelogen!! Bitte teilt ALLE diesen Beitrag und glaubt nicht diesen Medien. Helft mir!!! Gott beschütze euch alle meine Brüder und Schwester.‘

Beobachter des Verwirrspiels um das angebliche IS-Breitscheidplatz-Attentat gehen mittlerweile aufgrund der Faktenlage davon aus, dass es sich hierbei um Staatsterrorismus handelt und ein unschuldiger und nicht am Tatort anwesender Anis Amri, der ja schon zuvor von den Geheimdiensten beobachtet und behandelt wurde, hier von Politik und Behörden als vermeintlicher Täter vorgeschoben wurde.

Bevölkerungsmanagement durch Angst und Terror. Und der Begriff „Islamischer Staat“ ist doch der feuchte Propaganda-Traum eines jeden rassistischen Rechtsradikalen. In dem Bereich haben Politik und Behörden doch einiges an Connections und Eigenleistungen zu bieten, wie etliche Beispiele auch der jüngeren Vergangenheit zeigen, beispielsweise aus Hessen (19):

In der Frankfurter Neue Presse konnte man in dem Artikel „NSU-Mordserie. Verfassungsschützer Temme: Nichts gesehen, nichts gehört.„ zum NSU-Skandal Folgendes lesen (20):

„Ex-Verfassungsschützer Andreas Temme war im Kasseler Internetcafé, als dessen Besitzer der NSU-Mordserie zum Opfer fiel. Doch gesehen oder gehört haben will der Mann davon nichts. Das beteuert er auch in seiner zweiten Vernehmung in Wiesbaden. (…) Im Gegenteil, von dem Mord am Donnerstag habe er erst am Sonntag durch das Lesen eines örtlichen Anzeigenblatts erfahren. Allerdings wusste Temme nach Zeugenaussagen schon einen Tag später, mit welcher Waffe das Verbrechen begangen wurde. Und das stand nicht in dem Anzeigenblatt, wie ihm die SPD-Abgeordnete Nancy Faeser vorhielt.“

Junge Welt schrieb zu „Der Fall Temme“ (21):

„Das Oberlandesgericht (OLG) München hält laut Beschluss vom 12. Juli 2016 für glaubwürdig, dass der als Zeuge gehörte Andreas Temme, der damals im Nebenraum saß, keine Schüsse gehört habe – ein Mann, der seine Freizeit im Schützenverein verbringt. Es hält für nachvollziehbar, dass der hessische Verfassungsschützer Temme, der kurz nach dem Mordanschlag das Café verließ, nach dessen Angaben auf der Suche nach dem jungen Besitzer, dreimal an dem Sterbenden vorbeigegangen war, ohne ihn hinter einem Tisch liegen zu sehen. Es hält für glaubwürdig, dass der rund 1,90 Meter große V-Mann-Führer weder die Blutspritzer auf dem 73 Zentimeter hohen Tisch sah, auf den er ein Geldstück für die Computernutzung legte, noch den dahinter liegenden Halit Yozgat.“.

Das Telepolis-Magazin titelte „Verfassungsschutz will NSU-Bericht für 120 Jahre wegschließen„ (22):

„120 Jahre – für diese Dauer hat das Landesamt für Verfassungsschutz (LfV) von Hessen einen internen Bericht gesperrt, in dem es auch um den NSU-Mord von Kassel und die mögliche Verwicklung seines Mitarbeiters Andreas Temme gehen dürfte. Das schürt einerseits den Verdacht: Was derart lange geheim gehalten werden soll, muss brisant sein. Andererseits kann diese absurde Sperrfrist als Botschaft verstanden werden an die Öffentlichkeit und diejenigen, die weiterhin aufklären wollen: ‚Von uns erfahrt Ihr nichts mehr. Gebt auf!‘ Es ist ein unverblümter Bruch einer Sicherheitsbehörde mit dem Legalitätsprinzip im Rechtsstaat BRD, Ausdruck des verzweifelten Abwehrkampfes gegen die anhaltenden Aufklärungsbemühungen im Mordkomplex NSU.“

In einem Beitrag der Frankfurter Rundschau hieß es zu Temme (23):

„Bisher hatte es stets geheißen, Temme habe nur den Neonazi Benjamin Gärtner als V-Mann in der extremen Rechten geführt und dazu fünf Spitzel unter Islamisten. Temme hatte aber offenbar zu weiteren Rechtsextremen Kontakt: Nach FR-Informationen führte er zwei weitere Neonazis vertretungsweise, wenn sein Kasseler Chef vom Landesamt für Verfassungsschutz Hessen (LfV), Frank-Ulrich Fehling, krank oder in Urlaub war. Wie oft das vorkam und wie intensiv diese Kontakte waren, ist bisher nicht bekannt. Bereits am Donnerstag hatte Temmes frühere Vorgesetzten Iris Pilling, heute Abteilungsleiterin beim LfV Hessen, vor dem NSU-Untersuchungsausschuss des Bundestags anklingen lassen, dass Temme einen Kollegen als V-Mann-Führer vertreten haben könnte. Sie wurde dazu auch in geheimer Sitzung befragt.“

In dem Artikel „Kannte Bouffier Temme?“ meldete die Frankfurter Rundschau dann, dass Temme zum Amtmann befördert und in das Kasseler Regierungspräsidium des später ermordeten Walter Lübcke versetzt wurde (24):

„Der damalige Innenminister und heutige Ministerpräsident Volker Bouffier (CDU) soll mindestens einmal an einem ‚CDU-Arbeitskreis im Verfassungsschutz‘ teilgenommen haben, den auch der umstrittene ehemalige Verfassungsschützer Andreas Temme zeitweise aufsuchte. (…)

Andreas Temme war zeitweise unter Tatverdacht geraten, bis im Januar 2007 die Ermittlungen gegen ihn eingestellt wurden. Er kehrte nicht zum Verfassungsschutz zurück, sondern wurde zum Regierungspräsidium Kassel versetzt und ‚zum Amtmann befördert‘, wie die Initiative schreibt. (…)

Sie führt die Ungereimtheiten auf, die mit Andreas Temme verbunden sind. So habe es nach den Erkenntnissen des NSU-Untersuchungsausschusses ‚kein echtes dienstrechtliches Disziplinarverfahren gegen ihn‘ gegeben.“

Später meldete die Frankfurter Rundschau: „Mordfall Lübcke. Verfassungsschützer Temme war mit Stephan E. befasst“ (25):

„Der frühere hessische Verfassungsschützer Temme hatte dienstlich mit dem mutmaßlichen Lübcke-Mörder zu tun.“

Bei „junge Welt“ hieß es in dem Interview mit Prof. Funke mit dem Titel „»Bouffier müsste zurücktreten« Lübcke-Mord und gesperrte NSU-Akten: Sachverständiger fordert politische Konsequenzen. Ein Gespräch mit Hajo Funke„ zu dem Politik-Behörden-NSU-Skandal (26):

„Junge Welt: Hessens Ministerpräsident Volker Bouffier hat letzte Woche ‚rückhaltlose Aufklärung‘ versprochen, nachdem der Neonazi Stephan Ernst als Hauptverdächtiger im Fall des Mordes an dem Kasseler Regierungspräsidenten Walter Lübcke festgenommen worden war. Wirkt diese Aussage von Bouffier aus Ihrer Sicht glaubwürdig?

Funke: Rückhaltlose Aufklärung würde bedeuten, dem Generalbundesanwalt alle nötigen Akten aus Hessen zur Verfügung zu stellen. Wir erleben aber seit Tagen, dass dies nicht geschieht. Das hessische Landesamt für Verfassungsschutz hat sich nur bereit erklärt, die Akte von Stephan Ernst selbst zu übermitteln. Aber die Akten der Nachuntersuchung des Landesamts für Verfassungsschutz zum NSU sollen nach wie vor für 120 Jahre unter Verschluss gehalten werden. Auch die Bundesanwaltschaft hat sie bisher nicht. Bouffier müsste zurücktreten, wenn er weiterhin die Aufklärung behindert, wie schon im Fall des NSU-Mordes an Halit Yozgat 2006.

Da darf man sich dann auch nicht mehr wundern, wenn selbst der Europäische Gerichtshof entscheidet, dass deutsche Staatsanwaltschaften nicht zur Ausstellung eines Europäischen Haftbefehls befugt sind, weil sie laut Urteil nicht unabhängig von den Weisungen der Landesjustizminister sind. Legal Tribune Online meldete dazu (27):

„Die deutschen Staatsanwaltschaften bieten keine hinreichende Gewähr für Unabhängigkeit gegenüber der Exekutive, um zur Ausstellung eines Europäischen Haftbefehls (EuBH) befugt zu sein. Das hat die Große Kammer des Europäischen Gerichtshofs (EuGH) am Montag entschieden, (Urt. v. 27.05.2019, Az. C-508/18). (…)

Für die Staatsanwaltschaften in Deutschland sei nicht gesetzlich ausgeschlossen, dass im Einzelfall doch eine Weisung eines Landesjustizministers Einfluss auf ihre Arbeit nehmen könnte, so die Richter in Luxemburg am Montag. Ansatzpunkt für die Entscheidung des EuGH ist eine Formulierung in Art. 6 Abs. 1 des entsprechenden EU-Rahmenbeschlusses zum Haftbefehl (2002/584/JI), nach welcher der Haftbefehl nur von einer ‚Justizbehörde‘ in einem Mitgliedstaat ausgestellt werden darf. Diese müsse entsprechend ‚unabhängig‘ arbeiten können.“

Verweise

(1) https://www.rubikon.news/artikel/staatstheater-zu-weihnachten
(2) https://www.heise.de/tp/features/Keine-Fingerabdruecke-und-DNA-Spuren-von-Amri-im-Tat-LKW-4678366.html
(3) https://www.heise.de/tp/features/Die-offizielle-Anschlagsgeschichte-wird-immer-bizarrer-4722838.html
(4) https://www.heise.de/tp/features/Anis-Amri-Ich-habe-mit-dieser-Sache-nichts-zu-tun-Helft-mir-4988291.html
(5) https://blog.fdik.org/2019-12/s1576929449.html
(6) https://www.welt.de/vermischtes/article160454887/Mutiger-Zeuge-fuehrt-die-Polizei-zum-Verdaechtigen.html
(7) https://www.spiegel.de/politik/deutschland/anschlag-in-berlin-warum-der-tatverdaechtige-naved-b-wieder-auf-freiem-fuss-ist-a-1126862.html
(8) https://blog.fdik.org/2019-12/s1576929449.html
(9) https://heise.de/-4608078
(10) https://blog.fdik.org/2018-09/s1536487971.html
(11) https://hajofunke.wordpress.com/2013/10/16/thomas-moser-ein-verfassungsschutzer-am-tatort-und-eine-anklagebehorde-die-akten-unterdruckt/
(12) http://friedensblick.de/8450/kiesewetter-mord-das-geluege-um-den-nsu-wohnwagen/
(13) https://www.taz.de/!5407898/
(14) http://spon.de/aeT7R
(15) https://heise.de/-4075337
(16) http://to.welt.de/HNjeBAU
(17) https://www.tagesspiegel.de/politik/geheimdienst-affaeren-verfassungsschutz-praesident-liess-berichte-zu-amri-spitzel-unterdruecken/22999444.html
(18) https://www.heise.de/tp/features/Anis-Amri-Ich-habe-mit-dieser-Sache-nichts-zu-tun-Helft-mir-4988291.html
(19) http://blauerbote.com/2020/12/06/die-corona-propaganda-schneidet-sich-ins-eigene-fleisch/
(20) http://www.fnp.de/rhein-main/Verfassungsschuetzer-Temme-Nichts-gesehen-nichts-gehoert;art801,2046682
(21) http://www.jungewelt.de/2016/07-25/012.php
(22) https://www.heise.de/tp/features/Verfassungsschutz-will-NSU-Bericht-fuer-120-Jahre-wegschliessen-3772330.html
(23) https://www.fr.de/politik/temme-fuehrte-mehr-v-leute-bekannt-11062662.html
(24) https://www.fr.de/rhein-main/nsu-prozess-ere68532/kannte-bouffier-temme-11057378.html
(25) https://www.fr.de/politik/hessen-verfassungsschuetzer-temme-stephan-befasst-13126669.html
(26) https://www.jungewelt.de/loginFailed.php?ref=/artikel/357516.aufkl%C3%A4rungsblockade-bouffier-m%C3%BCsste-zur%C3%BCcktreten.html
(27) https://www.lto.de/recht/justiz/j/eugh-europaeischer-haftbefehl-deutsche-staatsanwaelte-nicht-unabhaengig/


Der Elfte September

Die False-Flag-Attacken vom 11.9.2001 und ihre Auswirkungen offenbaren den blanken Rassismus der Westlichen Wertegemeinschaft und ihren Kampf gegen Wissenschaft und Aufklärung.

Vor zwanzig Jahren zog sich die US-Regierung einen Freifahrtschein für einen „War on Terror“, mit dem der Erdball vor allem im globalen Süden überzogen wurde und der Millionen Ausländern den Tod brachte. An der Heimatfront und bei den Verbündeten wurden die eigenen Bürger zurechtgestutzt und „eingedost“. Dass die offizielle Story zu den vorgeblich von der Terrororganisation Al Qaida unter ihrem Führer Osama bin Laden durchgeführten Anschlägen in den USA nicht nur voll von Widersprüchen, sondern für jeden Menschen, der einigermaßen bei Verstand und guten Willens ist, klar als „Bullshit“ zu identifizieren ist, aber trotzdem durchgesetzt wird, scheint für viele der selbsternannten Herren der Menschheit eher ein befriedigender Potenzbeweis als ein Problem zu sein. Wer in der Coronakrise sagt „aber, aber, das würden die doch niemals tun“, der sieht bei 9/11 deutlich, dass sie es tun und schon getan haben, wenn auch auf etwas niedrigerem Level.

Gleich eingangs soll hier an einem einfachen und für jeden klar verständlichen Beispiel gezeigt werden, dass die offizielle Geschichte des Elften Septembers falsch ist und US-Regierung und Co Täter sind und keine Opfer. Wer nach Ansicht der Bilder der offiziellen Einschlagstelle am Pentagon, dem Sitz des US-Verteidigungsministeriums, immer noch behauptet, bei Kritikern der amtlichen 9/11-Theorie handele es sich um Spinner oder Antisemiten, und jegliche Diskussion ablehnt, der spuckt auf die Grundlagen der Physik und den Menschenverstand und will vielleicht einen Kampf gewinnen, in dem er sich wähnt, aber sicher keine Aufklärung der wirklichen Umstände betreiben.

Bild 1: Amtliche Boeing-757-Einschlagsstelle in Arlington am Pentagon bei 9/11. Foto oben rechts: Direkt nach dem Einschlag, US Navy (1). Foto links: Kurz vor dem Zusammensturz mit offizieller „quadratischer“ Einschlagstelle in der unteren Mitte des Bildes, US Marine Corps, Wikimedia (2). Foto unten rechts: Nach dem Zusammenbruch, US Air Force, Wikipedia (3).

Schon ein Blick auf die vermeintliche Pentagon-Einschlagstelle in Arlington zeigt, dass hier kein Passagierflugzeug von ungefähr 50 Meter Länge mit einer Flügelspannweite von 38 Metern und einem Gewicht von über 100000 Kilogramm plus zehntausender Liter Treibstoff – der Flug sollte nach Los Angeles gehen – ein kleines Mauerloch verursacht hat, und das, ohne die umliegenden Fenster zu beschädigen. Auf dem US-Navy-History-Foto oben rechts, das die Situation direkt nach dem Einschlag zeigt, sieht das Verhalten der umstehenden Personen eigentlich eher nach einer Übung samt Evakuierung als nach katastrophalem Ernstfall aus. Den offiziellen Angaben zufolge sind hier gerade alleine am Boden, ohne Flugzeuginsassen, 125 Menschen gestorben – oder liegen zu diesem Zeitpunkt noch im Sterben (4). Das Foto links zeigt die Situation später, kurz vor dem Gebäude-Zusammensturz, samt offizieller „quadratischer“ Einschlagstelle. Das Foto unten rechts zeigt diese Stelle später während der Bergungsarbeiten, nach dem Zusammenbruch dieses Gebäudeteils.

Bild 2: Rechts die offizielle schräge Anflugroute des Verkehrsflugzeuges auf das Pentagon, Grafik der US Navy (5). Links ein Foto der US Army mit „geradem Schadensbild“, Aufnahme nach dem Einbrechen der Obergeschosse (6).

Da im Bereich der angeblichen Katastrophenstelle der frontale Anflug auf das Pentagon-Gebäude für ein Flugzeug im Tiefflug so gar nicht möglich – da verbaut – ist, musste man sich hinsichtlich der vermeintlichen Anflugroute des Flugzeuges etwas einfallen lassen und hat die hier oben im Bild rechts zu sehende Grafik veröffentlicht, welche die offizielle Anflugroute der Boeing-757 zeigt: Schräg ins Gemäuer, gerade noch so an dem Generator vorbei, der neben den Baucontainern steht. Dass dieser „schräge Vogel“ dem Vergleich mit der Realität nicht standhält, zeigen die oben gezeigten Fotos der offiziellen Impact-Stelle. Man beachte auch die beeindruckende Stabilität der Mauern links, die dem angeblich schräg in sie rein einschlagenden Flugzeug genauso gut standhielten wie die Fenster über der „Einschlagstelle der Boeing 757“.

Wissenschaft, Aber-Aber-Ritual und Antisemitismus

Beliebt als „Angriffswerkzeug“ nach dem Verweis auf solche Bilder ist die Unterstellung, man würde behaupten, in die beiden WTC-Türme in New York seien ja gar keine Flugzeuge eingeschlagen. „Aber, aber, ich habe doch mit eigenen Augen die Flugzeuge in die Türme einschlagen sehen!“ heißt es dann, einhergehend mit der stillschweigenden, aber druckvollen Behauptung, der Kritiker sei ein Spinner. Nur ist es eben so, dass bei den Anschlagsstellen in New York im Wesentlichen die Art und Weise des Zusammenbruchs der Zwillingstürme Stunden nach den Einschlägen kritisiert wird, der nach Art einer geplanten Sprengung ablief, und darüber hinaus der Zusammenbruch beziehungsweise die Sprengung eines weiteren Turms neben diesen beiden Türmen, WTC-7, in den kein Flugzeug flog. Die wirkliche wissenschaftliche Antwort auf diese Unterstellung, die ja de facto ein Ablenkungsmanöver ist, und sei es aus Verzweiflung, weil man die Realität nicht wahrhaben will oder geschockt ist, ist aber, dass die Ereignisse in New York hier gar nicht relevant sind. Bricht eine Säule der offiziellen Theorie zusammen, bricht alles zusammen. Das nennt man Wissenschaft. Es wird doch nicht eine Lüge dadurch geheilt, dass man an einer anderen Stelle – vermeintlich – Recht hat. So funktioniert das nicht. Man kann nicht einfach so lange ein „Aber-Aber-Ritual“ durchführen, bis das Gegenüber – vermeintlich – keine Antwort mehr hat, indem es beispielsweise an der Forderung gescheitert ist, alle Schuhgrößen der damaligen Hausmeister der WTC-Türme auswendig und korrekt Personen zugeordnet aufzusagen, nur um dann selbst halb im Wahn zu brüllen „Ha, ich hatte doch recht! Stimmt ja gar nicht! Stimmt ja gar nicht!“. Was hier spaßeshalber etwas übertrieben dargestellt wurde, findet vom Grundprinzip her ständig statt, hat aber mit Wissenschaft und Aufklärung nichts zu tun.

Eine beliebte Waffe gegen Wissenschaftler und andere Zweifler ist neben dem Propagandaclaim „irrer Verschwörungstheoretiker“ und dem Aber-Aber-Ritual der – haltlose – Antisemitismusvorwurf. Selbstverständlich gibt es keinen wissenschaftlichen Zusammenhang zwischen der Forderung nach einer naturwissenschaftlich-physikalischen Betrachtung von Ereignissen und Hass auf Juden. Das ist doch völlig irrwitzig. Vor dem zwanzigsten Jahrestag der 9/11-Terrorangriffe kann man allerdings in den Medien Folgendes finden:

Bild 3: Links der Tagesspiegel (7), rechts der NDR zu 9/11 und Antisemitismus (8).

Der Berliner Tagesspiegel schreibt am 10.9.2021:

„Antisemitismus und Fake News: Wie sich Verschwörungstheorien nach 9/11 unter Berliner Jugendlichen ausbreiteten. Immer wenn etwas Böses passiert, wird nach Sündenböcken und alternativen Fakten gesucht. Woher Verschwörungsmythen nach 9/11 kamen und wer sie weiterverbreitet hat.“

Beim ARD-Sender NDR heißt es zur Sendung ZAPP vom 8.9.2021:

„9/11 und Verschwörungstheorien: 20 Jahre danach. 20 Jahre nach dem 11. September 2001 werden noch immer krude Verschwörungsmythen über die Attentate verbreitet: in sozialen Medien, Dokus oder im Deutschrap. Stets werden darin Schuldige ausgemacht – und zwar keine islamistischen Terroristen. Mal steckt angeblich die US-Regierung dahinter, mal eine ‚jüdische Weltverschwörung‘. Was macht das mit den Hinterbliebenen? Welche Folgen hat das für Jüdinnen und Juden, die mit diesen oft antisemitischen Verschwörungsnarrativen angefeindet werden? Und welche Verantwortung tragen die Plattformbetreiber, die solche Inhalte zur Verfügung stellen?“

Der Antisemitismusvorwurf gegen Kritiker offizieller Narrative wird mittlerweile im Prinzip beliebig eingesetzt, wie nicht nur bei 9/11, sondern vor auch in der Coronakrise und bei anderen Themen zu beobachten ist. Dabei macht die Antisemitismusverleumdung nicht einmal vor Juden halt (9). So musste sich beispielsweise die kürzlich verstorbene Auschwitz-Überlebende und überzeugte Antifaschistin Esther Bejarano von nicht-jüdischem deutschen „Jungvolk“ als Antisemitin beschimpfen lassen, weil sie dessen Ansichten nicht teilte, und Moshe Zuckermann, Professor für Geschichte und Philosophie sowie jüdischer Sohn von Holocaust-Überlebenden, erleidet das gleiche Schicksal, wie er in einem Interview berichtet (10, 11). Bei den verleumdenden Personen handelt es sich im Wesentlichen um die gleichen Pseudolinken, die sich heute in der Coronakrise für Machteliten-Politik prügeln wollen, und keine tatsächlichen Linken, sondern eher dauerbeleidigte Wohlstandskinder darstellen. Ein wesentlicher Teil dieser lautstarken Gruppen sind sich selbst als „Antideutsche“ betitelnde Personen, die eben auch, zusätzlich zu einigen Journalisten, Politikern etc., beim Thema 9/11 aktiv sind. Der Schutz der westlichen Machteliten ist für sie gleichbedeutend mit „Kampf gegen Antisemitismus“. Einen ungefähren Einblick in diese „Denkweise“ erlaubt ein Auszug aus einem Interview bei Neues Deutschland vom November 2014 mit der in antideutschen Kreisen äußerst beliebten Band „Antilopengang“, die von der Band Die Toten Hosen – gefallene Punkrock-Helden mit Hang zur Merkel-Verehrung – stark gefördert wird (12, 13):

„Danger Dan: Also Blockupy fand‘ ich schon besonders dumm. Diese Idee es gäbe irgendwie 99% von Unterdrückten, die von einem Prozent Reicher unterdrückt werden – ein besseres Beispiel für verkürzte Kapitalismuskritik gibt’s eigentlich gar nicht. Da würde auch die NPD unterschreiben und mitmachen.

Koljah: Das ist ja auch schon fast Antisemitismus. Da ist ja schon der Aufruf zum Pogrom impliziert.

Danger Dan: Das das überhaupt noch geht, dass Linke sich auf so einen Unsinn einigen können, hat mich krass verwundert. Da bin ich dann doch sehr froh über Rechtsstaatlichkeit, über Polizisten, die diese Leute dann im Zaum halten. Und ich würde auch tatsächlich, wenn diese Leute sich erheben und das umsetzen wollen, was da zwischen den Zeilen angekündigt wird, dieses reiche eine Prozent – wer auch immer das sein soll – wenn die die jetzt lynchen würden, würde ich auch auf der Seite der Polizei gegen sie kämpfen. Mit Waffengewalt.

Koljah: Ich muss sagen: mich hat’s überhaupt nicht verwundert. Sondern das steht in der Tradition einer Linken, die in Deutschland spätestens seit 68 antisemitisch durchsetzt ist. Das passt dazu. Diese ganzen Proteste, die so tun als könne man nur »das Finanzkapital« kritisieren, die ein Bild von »guter Kapitalismus gegen schlechter Kapitalismus« zeichnen, bieten genau den Anknüpfungspunkt für Antisemitismus. […]

Danger Dan: Da wo solche abstrakten Probleme auf irgendwelche Minderheiten oder am Ende noch die Juden projiziert werden, bin ich aus dem Spiel raus und hab keine Lust darauf. Ich bin dann sehr skeptisch und bei mir gehen die Alarmglocken an. Und im Fall von Antisemitismus sind Juden die, die als Juden angegriffen werden. Das hat nichts mit Religion zu tun.“

Bizarre Claims

Eingangs wurde bereits aufgezeigt, dass die amtliche Verschwörungstheorie von Osama bin Laden, der aus einer Höhle in Afghanistan heraus neunzehn mit Teppichmessern bewaffnete Islamisten dirigierte, die in den USA vier Flugzeuge kaperten und damit die 9/11-Anschläge begingen, nicht haltbar ist. Auch das „Loch von Shanksville“ zeigt dies noch einmal deutlich auf. Hier war wie in Arlington am Pentagon ebenfalls kein Flugzeug am Werk:

Bild 4: Offizielle Absturzstelle von Flug 93 auf dem Feld in Shanksville, Pennsylvania, 11. September 2001. Der links in Großaufnahme zu sehende Krater ist im rechten unteren Foto genau in der Mitte zu sehen. Die beiden Fotos wurden von US-Behörden hergestellt und sind Public Domain, beispielsweise bei Wikipedia und Wikimedia erhältlich (14, 15, 16). Rechts oben das „Shanksville-Flugzeug“ drei Tage vor seiner Entführung, Wikipedia (17).

Wie jeder sehen kann, zeigen die beiden offiziellen Fotos der 9/11-Shanksville-„Absturzstelle“, dass dort kein großes Verkehrsflugzeug abgestürzt ist. Man sieht einen kleinen Einschlagskrater von vielleicht gerade Mal fünf Metern Durchmesser. Man beachte die Fahrzeuge und Bäume im rechten unteren Bild und vergleiche das mit dem kleinen Krater in der Mitte dieses Fotos. Man beachte die beiden Menschen mit den weißen Hosen, die neben dem links in Großaufnahme zu sehenden Krater stehen. Dieses Mini-Loch kann niemals die Einschlagstelle einer Passagiermaschine sein.

Dass an der ganzen 9/11-Story etwas faul ist, hätte man sich allerdings auch ohne die gezeigten Bilder bereits denken können. Die Kurzfassung:

1. USA gründet Al Qaida („Mudschaheddin“) – sagt selbst Hillary Clinton (18).

2. „Al Qaida“ begeht laut USA 9/11-Anschläge (3000 Tote) in 2001 in USA (19).

3. USA und Al Qaida überfallen gemeinsam Syrien (seit 2011), Libyen, Yemen…(20)

Die Figur „Osama bin Laden“ taucht nicht erst mit den Anschlägen in den USA auf der Bildfläche auf. Osama bin Laden war vorher ganz offiziell „unser Mann in Afghanistan“, wo er als Führer der Qaida für die US-Amerikaner gegen die sowjetischen und afghanischen Truppen kämpfte (21). Es gibt da dieses berühmte Foto von Bin Laden in einem nicht weniger berühmten Artikel der britischen Zeitung Independent aus dem Jahre 1993, der den amtlichen Terroristenchef als unseren Helden im Kampf gegen die Sowjetunion in Afghanistan feiert.

Bild 5: Foto des Independent-Artikels zu Bin Laden (22).

Der Independent hat mittlerweile das Bin-Laden-Foto aus der Onlineversion des Artikels entfernt („Photograph omitted“). In dem Artikel mit der Überschrift „Anti-Soviet warrior puts his army on the road to peace: The Saudi businessman who recruited mujahedin now uses them for large-scale building projects in Sudan. Robert Fisk met him in Almatig“ von 1993 geht es um die – angebliche – Zeit der Figur Bin Laden nach dem Kampf seiner Mudschaheddin-Jihadisten – später als „Al Qaida“ tituliert – gegen die sowjetische Armee in Afghanistan: Er hielt sich danach laut Independent-Artikel im Sudan auf und soll sich dort im Straßenbau verdient gemacht haben (22).

Als 2016 im Syrienkrieg der Kampf der syrischen Truppen gegen die die prowestlichen Besatzer von Aleppo anstand, konnte man einen Sprecher des US-Verteidigungsministeriums folgendes sagen hören (23):

“That said, it’s primarily al-Nusra who holds Aleppo”

Al Nusra ist der in Syrien tätige Arm der Al Qaida und das bestreitet weder Freund noch Feind. Mittlerweile wurde Al Nusra umbenannt etc.. Die Qaida – „Rebellen“ genannt – hielt also nach Angaben des US-Militärs Aleppo beziehungsweise Ost-Aleppo, vom Westen unterstützt und mit Waffen beliefert. Bekannt war das schon lange vor der hier zitierten Aussage und blitzte auch schon Mal bei TagesschauSpiegel und Co durch (24, 25, 26).

al_kaida_christoph_sydow_spiegel

Bild 6: Screenshot aus Spiegel Online, hoffen auf Al-Qaida-Truppennachschub (26, 27).

An diesem Punkt stellt sich doch jedem, der klar bei Verstand ist, die Frage, wie es denn bitte sein kann, dass man als US-Regierung beziehungsweise Westliche Wertegemeinschaft auch nur in Erwägung zieht, mit Al Qaida zu kämpfen beziehungsweise diese einzusetzen, geschweige denn, dies tatsächlich wenige Jahre nach den vorgeblichen Jahrhundertanschlägen der Al Qaida in den USA auch zu tun. 2011 begann der als „syrischer Bürgerkrieg“ getarnte Angriff auf Syrien, unter anderem mit ausländischen Kämpfern von Al Qaida, und quasi parallel dazu hat man ganz offiziell die Figur Osama bin Laden entsorgt, der den amtlichen Angaben zufolge am 2. Mai 2011 in Pakistan nicht etwa festgenommen, sondern getötet wurde, und dessen Leiche man leider direkt entsorgt hat… Wikipedia schreibt zu Letzterem (28):

„Bin Ladens Identität wurde nach Angaben der US-Regierung mit einer DNA-Analyse festgestellt und sein Leichnam noch am 2. Mai 2011 an geheimer Stelle von Bord des US-Flugzeugträgers USS Carl Vinson im Arabischen Meer bestattet.“

Ein neues blutiges Jahrhundert, im Notstand

Der Nationale Notstand in den USA, der aufgrund der „9/11-Al-Qaida-Angriffe“ erlassen wurde, wird seit 20 Jahren jedes Jahr vom jeweiligen US-Präsidenten verlängert. Bush, Obama, Trump und jetzt Biden am 9. September 2021 (29): Sie alle verlängerten immer wieder ihre Notstandsbefugnisse in einer „Notice on the Continuation of the National Emergency with Respect to Certain Terrorist Attacks“.

Der „War on Terror“ seit 2001 hat außerhalb des Westens Millionen Menschenleben gekostet, die bei den Führern und Aktivisten der Westlichen Wertegemeinschaft keine Bedeutung zu haben scheinen. Der blanke Rassismus. Dazu hat man noch ein paar hundert Unschuldige eingefangen, die selbstverständlich mit den Terrorattacken von 9/11 nichts zu tun haben können, wie wir bereits eingangs mit der Aufdeckung des False-Flag-Charakters der Anschläge gesehen haben, und hat sie zum demonstrativen Durchfoltern in Guantanamo oder zur heimlichen Folter an noch finstereren Orten eingekerkert. Einige sitzen da heute noch. Alles offenbar „scheißegal“. Der blanke Rassismus. Der Gefangene Ahmed Rabbani hat Anfang 2021 einen Brief an US-Präsident Biden geschrieben, aus dem hier ein kleiner Auszug zitiert werden soll (30, 31):

„Als ich 2002 in Karachi gekidnappt wurde und an die CIA für ein Kopfgeld verkauft wurde mit einer falschen Story, dass ich ein Terrorist namens Hassan Gul sei. Meine Frau und ich hatten gerade die gute Auskunft bekommen, dass sie schwanger war. Ein paar Monate später gebar sie meinen Sohn Jawad. Mir wurde niemals erlaubt, mein eigenes Kind zu sehen. Präsident Biden ist ein Mann, der von der Bedeutung der Familie spricht. Ich frage mich, ob er sich vorstellen kann, was es bedeutet, niemals den eigenen Sohn berührt zu haben. Meiner wird bald 18 Jahre alt sein und ich bin nicht dort gewesen, um ihm zu helfen oder ihn zu leiten. (…)

Der Bericht des Geheimdienstausschusses des Senats über die CIA-Folter wurde ‚unter seiner Aufsicht‘ 2014 abgeschlossen, wie man sagt. Es ist ein Report, in dem ich vorkomme. Darin steht, dass ich 540 Tage gefoltert wurde in einem ‚Dunkel-Gefängnis‘ in Afghanistan ‚ohne Erlaubnis‘ – ob das besser oder schlechter ist, kann ich nicht entscheiden

Ich kann bestätigen, dass die Folter stattfand, obwohl ich die Tage und Nächte nicht selbst zählen konnte: die Tage und Nächte flossen zu einem Block zusammen, als ich in einer finsteren Grube an einer Stange aufgehängt war und mir die Arme unter Qualen aus den Schultern auskugelten.

Ich zweifle, ob Präsident Biden verstehen kann, was diese Folter bedeutet; eine Frau im Nebenraum schreien zu hören und einem gesagt wird, dass es deine Frau ist, und dass, wenn ich nicht tue, was sie sagen, sie vergewaltigt oder getötet wird.“

Türme und noch ein Einsturz

Jetzt sind wir am Ende des Artikels angelangt und der Einsturz der drei Türme in New York, nachdem zwei davon von Flugzeugen getroffen wurden, der immer so im Fokus steht, wurde gar nicht behandelt. Man muss das auch nicht, um nachzuweisen, dass die Geschichte der US-Regierung zu 9/11 nicht stimmt, wie wir gleich eingangs gesehen haben. Für Interessierte gibt es allerdings genug Material, das aufzeigt, dass die Türme nur gesprengt worden sein können und nicht einfach so zusammengebrochen sind. Glücklicherweise haben sich auch einige aufrechte Physiker und Ingenieure des Themas angenommen und die Sache überprüft und durchgerechnet. Im Prinzip kann aber jeder Amateur schon beim Anschauen der Fall-Videos von WTC-1, WTC-2 und WTC-7 leicht erkennen, dass das jeweils einer Abbruchsprengung eines Hochhauses verdammt ähnlich sieht und dass die Wolkenkratzer fast im freien Fall, ohne Widerstand, zu Boden rauschen, was eben nur durch eine Sprengung möglich ist, wie auch immer diese technisch durchgeführt wurde. Die völlig ausgebrannten Hochhäuser in London und Peking, die im Gegensatz zu dem mit einem Stockwerksbrand „ausgestatteten“ WTC-7 einfach stehengeblieben sind, dürfte wohl auch jeder kennen…(32, 33)

Die offizielle „Theorie“ zu 9/11 ist längst eingestürzt, man muss die Nachricht davon nur noch verbreiten (34-52). Wer dahingehend noch zaudert, dem sei zur Entscheidungsfindung höflichst ein kleines Gedankenspiel empfohlen: Stellen Sie sich vor, Sie würden Ahmed Rabbani bei einem Besuch in Guantanamo Bay gegenüberstehen und sollten ihm erklären, dass sie keine Texte zur Aufklärung von 9/11 weiterverbreiten wollten, weil Sie Angst hatten, dass Sie bei Verbreitung solcher Aussagen vielleicht irgendwann einmal eine Facebook-Sperre hätten bekommen können.

Links

(1) https://www.history.navy.mil/content/history/nhhc/research/library/online-reading-room/title-list-alphabetically/p/pentagon-9-11-footnotes/_jcr_content/body/image_14.img.jpg/1438613592644.jpg
(2) https://commons.wikimedia.org/wiki/File:DM-SD-02-03880.JPEG
(3) https://en.wikipedia.org/wiki/File:Aerial_view_of_the_Pentagon_during_rescue_operations_post-September_11_attack.JPEG
(4) https://en.wikipedia.org/wiki/Victims_of_Terrorist_Attack_on_the_Pentagon_Memorial
(5) https://www.history.navy.mil/content/dam/nhhc/research/library/online-reading-room/pentagon911/pentagon_911-8.jpg
(6) http://blauerbote.com/wp-content/uploads/2021/09/army_mil_pentagon.jpg
(7) https://plus.tagesspiegel.de/berlin/antisemitismus-und-fake-news-wie-sich-verschwoerungstheorien-nach-911-unter-berliner-jugendlichen-ausbreiteten-243077.html
(8) https://www.ndr.de/fernsehen/sendungen/zapp/9-11-und-Verschwoerungstheorien-20-Jahre-danach,gefaehrlichemyth100.html
(9) https://projektkritischeaufklaerung.de/de/konferenz-in-berlin-am-10-februar-2018/
(10) http://blauerbote.com/2021/08/11/dokumentarfilm-zeit-der-verleumder-mit-moshe-zuckermann-rolf-becker-jackie-walker-ali-abunimah-moshe-machover-judith-bernstein-esther-bejarano-u-a/
(11) https://odysee.com/@Punkt.PRERADOVIC:f/Zuckermann:4
(12) http://blauerbote.com/2021/08/02/die-machteliten-die-toten-afrikaner-und-die-absicherung-der-herren-durch-beleidigte-wohlstandskinder/
(13) https://www.nd-aktuell.de/artikel/951837.punk-hat-viele-widerspruechliche-inhalte.html
(14) https://fr.m.wikipedia.org/wiki/Fichier:Flight_93_Crater.jpg
(15) http://blauerbote.com/wp-content/uploads/2019/11/flight_93_crash_crater_911_shanksville_pennsylvania_september11_united_airlines_usa_2001_terror.png
(16) https://commons.wikimedia.org/wiki/File:Flight93Crash.jpg
(17) https://en.wikipedia.org/wiki/United_Airlines_Flight_93#/media/File:N591UA.jpg
(18) http://blauerbote.com/2018/07/27/noam-chomsky-hillary-clinton-we-created-al-qaeda-isis/
(19) http://blauerbote.com/2019/09/20/was-ist-911/
(20) http://blauerbote.com/2018/09/05/laut-usa-und-tagesschau-handelt-es-sich-bei-den-rebellen-in-syrien-um-al-qaida/
(21) http://blauerbote.com/2018/10/08/zbigniew-brzezinski-afghanistan-al-qaida-und-osama-bin-laden/
(22) http://www.independent.co.uk/news/world/anti-soviet-warrior-puts-his-army-on-the-road-to-peace-the-saudi-businessman-who-recruited-mujahedin-1465715.html
(23) http://www.defense.gov/News/Transcripts/Transcript-View/Article/739157/department-of-defense-press-briefing-by-col-warren-via-teleconference-from-bagh
(24) http://blauerbote.com/2017/03/18/syrien-ost-aleppo-wurde-von-al-qaida-beherrscht/
(25) http://blauerbote.com/2018/09/05/laut-usa-und-tagesschau-handelt-es-sich-bei-den-rebellen-in-syrien-um-al-qaida/
(26) http://blauerbote.com/2016/08/02/der-spiegel-feuert-al-kaida-an-die-islamisten-sind-aleppos-letzte-hoffnung/
(27) https://www.spiegel.de/politik/ausland/syrien-die-islamisten-sind-aleppos-letzte-hoffnung-a-1105806.html
(28) https://de.wikipedia.org/wiki/Osama_bin_Laden
(29) https://www.whitehouse.gov/briefing-room/presidential-actions/2021/09/09/notice-on-the-continuation-of-the-national-emergency-with-respect-to-certain-terrorist-attacks/
(30) https://einarschlereth.blogspot.com/2021/02/ich-bin-ein-gefangener-in-guantanamo.html
(31) http://blauerbote.com/2021/02/05/ich-bin-ein-gefangener-in-guantanamo-bay-und-ich-habe-eine-botschaft-fuer-praesident-biden/
(32) http://blauerbote.com/2017/06/14/hochhausbrand-in-london-vs-wtc7-einsturz-bei-911/
(33) https://www.rubikon.news/artikel/20-jahre-terrorluge
(34) http://blauerbote.com/2021/09/09/118-augenzeugen-zu-9-11-das-zeugnis-der-feuerwehrleute-zu-den-explosionen-in-den-zwillingstuermen/
(35) https://www.rubikon.news/artikel/der-verklarte-tag
(36) https://www.rubikon.news/artikel/die-jahrhundertluge
(37) http://blauerbote.com/2016/09/05/physiker-fachblatt-zu-911-world-trade-center-einsturz-durch-kontrollierte-sprengung/
(38) https://www.europhysicsnews.org/articles/epn/pdf/2016/04/epn2016474p21.pdf
(39) https://www.rubikon.news/artikel/die-sprengung
(40) https://kenfm.de/akademische-naivitaet-und-der-11-september/
(41) https://www.amazon.de/Stigmatisierung-statt-Aufkl%C3%A4rung-%C2%BBVerschw%C3%B6rungstheorie%C2%AB-kontrafaktischen/dp/3862420019
(42) https://www.rubikon.news/artikel/selektive-wahrheitssuche
(43) https://www.rubikon.news/artikel/selektive-wahrheitssuche-2
(44) https://www.rubikon.news/artikel/der-pentagon-fake
(45) https://www.rubikon.news/artikel/der-scheinheilige-2
(46) https://www.radio-utopie.de/2016/09/10/15-jahre-terrorkrieg-und-11-september-wie-alles-begann/
(47) https://www.broeckers.com/911-2/
(48) https://www.rubikon.news/artikel/bilanz-eines-jahrhundertverbrechens
(49) http://antikrieg.com/aktuell/2019_08_08_dasverbrechen.htm
(50) http://blauerbote.com/2021/04/08/der-911-verschwoerungswahn/
(51) https://www.broeckers.com/2021/08/06/mythos-9-11-alles-klar-herr-kommissar/
(52) https://www.buchkomplizen.de/buecher-mehr/mythos-9-11.html


Das gewollte Narrativ

Augenzeugen berichten, dass der uns präsentierte Täter nicht der tatsächliche Mörder von Hanau ist — für den Medien-Mainstream stehen die Fakten jedoch bereits fest.

von Jens Bernert

Zu den Morden in Hanau gibt es zahlreiche Ungereimtheiten. Beim Massaker in der Sisha-Bar anwesende, überlebende Personen sowie weitere Augenzeugen sagen in Interviews mit türkischsprachigen Medien aus, dass der tatsächliche Mörder nicht derjenige ist, der von den Behörden und der deutschen Presse als Täter präsentiert wird.

In der Neuen Rheinischen Zeitung schreibt Yavuz Özoguz zu den Zeugenaussagen in dem Artikel „Betrachtung zu den Morden von Hanau am 19. Februar 2020. War das Massaker von Hanau eine Geheimdienstoperation? Täter und gezeigter Mörder sind nicht identisch!“ (1, 2):

„Am 19. Februar 2020 soll das Massaker in Hanau gegen 22:00 Uhr begonnen haben. Die erste französische Wikipedia-Seite dazu weiß bereits um 9:26 Uhr des nächsten Morgens, dass es ein Bekennervideo eines Tobias Rathjen gegeben habe (…). Als Quelle wird eine italienische Homepage angegeben, die das bereits um 8:55 Uhr wusste. Verwiesen wird auf ein Video bei YouTube, das bereits vor mehreren Tagen hochgeladen worden ist und zum Zeitpunkt dieses Berichtes nach wie vor existiert. Die darin auftretende Person ist ansonsten im Internet nicht auffindbar. Sein Name kommt zwar oft vor, gehört aber anderen Gesichtern. Fanpage.it ist eine Online-Zeitung mit Sitz in Neapel, die zur Verlagsgruppe Ciaopeople Media Group gehört, eine eher weniger bekannte Mediengruppe. Der Chefredakteur heißt Francesco Piccinini, über den im Netz herzlich wenig zu finden ist. Die einzige Seite, die auf seinen Lebenslauf verweist, versucht beim Aufruf einen Virus auf dem eigenen Rechner zu installieren. Die italienische Homepage verweist wiederum auf die deutsche Bild-Zeitung, die das Ganze bereits um 8:47 Uhr publiziert haben will, also 8 Minuten vor dem italienischen Eintrag. Schaut man sich den ausführlichen Medienbericht der Italiener an, so kann der unmöglich innerhalb von 8 Minuten verfasst worden sein. Zudem beinhaltet die italienische Seite umfangreiche Übersetzungen des Videoinhaltes, die unmöglich in solch kurzer Zeit abgeschrieben und übersetzt worden sein können.“

Und weiter:

„In den türkischen Medien werden immer wieder türkischsprachige Interviews von Betroffenen und benachbarten Zeugen verbreitet, die in klarer und deutlicher Sprache darauf verweisen, dass der Täter und der in den Medien präsentierte Mörder absolut nicht identisch seien (siehe Minute 1:42 türkischsprachig).“

Bild

Bild: Screenshots der YouTube-Seite mit dem Augenzeugeninterview, Video und Kommentare

Im YouTube-Kanal von Haber Lüften ist ein Interview mit einem Augenzeugen der Tat von Hanau zu sehen. Der Mann sagt in die Kameras, dass der von Medien und Behörden präsentierte Täter und der tatsächliche Mörder nicht der Gleiche seien.

Die Kommentare unter dem YouTube-Video sind entsprechend aufschlussreich. Und sie machen Hoffnung:

Deutsch- und türkischstämmige Menschen sind sich mit anderen einig: Die wollen einen Keil zwischen uns treiben, aber wir lassen uns nicht aufhetzen!

„Er sagt als Augenzeuge, dass der Täter anders aussah…“

„Wahnsinn, jetzt benötigen wir schon türkische Quellen, um der Wahrheit näher zu kommen!“

„Mein Beileid an die türkische Gemeinde!!! Jungs, die halten uns ALLE zum Narren, hetzen uns gegeneinander auf und freuen sich, wenn wir aufeinander losgehen.“

„Die Medien wollen einfach einen Keil zwischen uns treiben, Hass von beiden Seiten erzeugen, da könnt ich echt kotzen!“

Die Morde von Hanau erinnern an die Ermordung von Halit Yozgat in seinem Internetcafé in Kassel, ebenfalls Hessen, im Rahmen des sogenannten NSU-Skandals:

Yozgat wurde während des laufenden Betriebes hinter seinem Tresen erschossen.

Bei dem NSU-Mord in Kassel war ein Mitarbeiter des Verfassungsschutzes – laut eigener Aussage – anwesend. Er musste dies vor dem parlamentarischen Untersuchungsausschuss zugeben, nachdem er sich in Widersprüche verstrickt hatte.

Der Mitarbeiter heißt Andreas Temme. Er wurde in das Regierungspräsidium des später erschossenen Walter Lübcke „strafversetzt“.

Die Kasseler Problematik

Die Umstände der Ermordung des Kasseler Internetcafébesitzers Halit Yozgat weisen deutlich auf eine Verstrickung staatlicher Stellen in den Mordfall hin.

Denn: Der zum Tatzeitpunkt anwesende hessische Geheimdienstler und Nazi-Verbindungsmann Temme – Spitzname „Klein Adolf“ – will nach eigener Aussage nichts von dem Mord mitbekommen haben, der bei den beteiligten Behördenkreisen auch „die Kasseler Problematik“ genannt wird (3).

Die schwarz-grüne hessische Landesregierung hat die Akten zu dem Fall für 120 Jahre weggeschlossen (4).

Die Junge Welt schreibt zum „Fall Temme“ (5):

„Das Oberlandesgericht (OLG) München hält laut Beschluss vom 12. Juli 2016 für glaubwürdig, dass der als Zeuge gehörte Andreas Temme, der damals im Nebenraum saß, keine Schüsse gehört habe – ein Mann, der seine Freizeit im Schützenverein verbringt. Es hält für nachvollziehbar, dass der hessische Verfassungsschützer Temme, der kurz nach dem Mordanschlag das Café verließ, nach dessen Angaben auf der Suche nach dem jungen Besitzer, dreimal an dem Sterbenden vorbeigegangen war, ohne ihn hinter einem Tisch liegen zu sehen. Es hält für glaubwürdig, dass der rund 1,90 Meter große V-Mann-Führer weder die Blutspritzer auf dem 73 Zentimeter hohen Tisch sah, auf den er ein Geldstück für die Computernutzung legte, noch den dahinter liegenden Halit Yozgat.“

Bei der Frankfurter Neue Presse heißt es in dem Artikel „NSU-Mordserie. Verfassungsschützer Temme: Nichts gesehen, nichts gehört“ (6):

„Ex-Verfassungsschützer Andreas Temme war im Kasseler Internetcafé, als dessen Besitzer der NSU-Mordserie zum Opfer fiel. Doch gesehen oder gehört haben will der Mann davon nichts. Das beteuert er auch in seiner zweiten Vernehmung in Wiesbaden. (…) Im Gegenteil, von dem Mord am Donnerstag habe er erst am Sonntag durch das Lesen eines örtlichen Anzeigenblatts erfahren. Allerdings wusste Temme nach Zeugenaussagen schon einen Tag später, mit welcher Waffe das Verbrechen begangen wurde. Und das stand nicht in dem Anzeigenblatt, wie ihm die SPD-Abgeordnete Nancy Faeser vorhielt.“

Da hilft dann wohl nur noch das Wegschließen von Akten, um Verwirrung zu stiften und abzulenken und vielleicht auch, um Beweise verschwinden zu lassen. Telepolis schreibt dazu in dem Artikel „Verfassungsschutz will NSU-Bericht für 120 Jahre wegschließen“ (7):

„120 Jahre – für diese Dauer hat das Landesamt für Verfassungsschutz (LfV) von Hessen einen internen Bericht gesperrt, in dem es auch um den NSU-Mord von Kassel und die mögliche Verwicklung seines Mitarbeiters Andreas Temme gehen dürfte. Das schürt einerseits den Verdacht: Was derart lange geheim gehalten werden soll, muss brisant sein. Andererseits kann diese absurde Sperrfrist als Botschaft verstanden werden an die Öffentlichkeit und diejenigen, die weiterhin aufklären wollen: ‚Von uns erfahrt Ihr nichts mehr. Gebt auf!‘ Es ist ein unverblümter Bruch einer Sicherheitsbehörde mit dem Legalitätsprinzip im Rechtsstaat BRD, Ausdruck des verzweifelten Abwehrkampfes gegen die anhaltenden Aufklärungsbemühungen im Mordkomplex NSU.“

Geheimdienstmann Temme bekam einen ruhigen Job im hessischen Innenministerium. Er wurde in das Kasseler Regierungspräsidium versetzt. Dieses wurde von dem vor wenigen Wochen ermordeten Walter Lübcke geleitet. Bei der Frankfurter Rundschau heißt es dazu (8):

„Der damalige Innenminister und heutige Ministerpräsident Volker Bouffier (CDU) soll mindestens einmal an einem ‚CDU-Arbeitskreis im Verfassungsschutz’ teilgenommen haben, den auch der umstrittene ehemalige Verfassungsschützer Andreas Temme zeitweise aufsuchte. (…) Andreas Temme war zeitweise unter Tatverdacht geraten, bis im Januar 2007 die Ermittlungen gegen ihn eingestellt wurden. Er kehrte nicht zum Verfassungsschutz zurück, sondern wurde zum Regierungspräsidium Kassel versetzt und ‚zum Amtmann befördert’, wie die Initiative schreibt. (…) Sie führt die Ungereimtheiten auf, die mit Andreas Temme verbunden sind. So habe es nach den Erkenntnissen des NSU-Untersuchungsausschusses ‚kein echtes dienstrechtliches Disziplinarverfahren gegen ihn’ gegeben.“

Der Lübcke-Mord

Leider hat die NSU-Thematik 2019 noch eine weitere Facette erhalten.

Walter Lübcke (CDU) war Abgeordneter des hessischen Landtages und Präsident des Kasseler Regierungspräsidiums. Er wurde am 2. Juni 2019 in seinem Haus getötet. Aufnahmen von Überwachungskameras gibt es offenbar nicht. In den Medien finden sich keine entsprechenden Angaben. Erstaunlicherweise war der zunächst als Einzeltäter präsentierte Stephan Ernst dann doch in der Mordnacht mit zwei Autos unterwegs (9).

Lübcke hatte bereits im März die Altersgrenze für seine Pensionierung erreicht, aber noch eine Verlängerung seiner Amtszeit als Regierungspräsident bis September beantragt (10).

Der Lübcke-Mord hat eine Verbindung zu der NSU-Mordserie, wie die hessische Landtagsabgeordnete Janine Wissler (Die Linke) in einem Interview im ZDF erläuterte (11):

„Ich finde, man muss insbesondere die Frage stellen: Ist das wirklich ein Einzeltäter, weil wir ja schon wissen, dass wir sehr vernetzte Neonazi-Strukturen auch haben. Gerade in Nordhessen, das war ein wichtiges Thema in diesem Untersuchungsausschuss. Na ja, und uns war eben besagter Stephan E. aufgefallen. Wir hatten 2015 explizit nach ihm gefragt. Wir haben das Landesamt für Verfassungsschutz nach ihm gefragt. Und die Behörden gefragt, was sie über diesen Mann wissen. Und da haben wir leider keine Antwort bekommen.“

Auf der Website der Tagesschau findet sich in dem Artikel „Razzia nach Lübcke-Mord. Mutmaßlicher Helfer als Neonazi bekannt“ ebenfalls ein Hinweis auf eine Verbindung zwischen dem mutmaßlichen Lübcke-Mörder Stephan Ernst und der NSU-Mordserie (12):

„Markus H., der Stephan E. Waffen vermittelt haben soll, war bereits 2006 im Zusammenhang mit dem Mord an Halit Yozgat in Kassel vernommen worden. Wie sich später herausstellte, war Yozgat vom NSU ermordet worden.“

Die Frankfurter Rundschau berichtete am 18. Oktober 2019 über Temme, der während der Ermordung von Yozgat in dem Internetcafé in Kassel anwesend war (13):

„Der frühere hessische Verfassungsschützer Temme hatte dienstlich mit dem mutmaßlichen Lübcke-Mörder zu tun.“

In Junge Welt spricht der Politikwissenschaftler Hajo Funke von einer Behinderung der Aufklärung des Mordfalls Lübcke durch die hessische Landesregierung – CDU und Grüne – und insbesondere Volker Bouffier, wie es sie auch in Falle der Ermordung von Yozgat gab (14):

„Junge Welt: Hessens Ministerpräsident Volker Bouffier hat letzte Woche ‚rückhaltlose Aufklärung’ versprochen, nachdem der Neonazi Stephan Ernst als Hauptverdächtiger im Fall des Mordes an dem Kasseler Regierungspräsidenten Walter Lübcke festgenommen worden war. Wirkt diese Aussage von Bouffier aus Ihrer Sicht glaubwürdig?
Funke: Rückhaltlose Aufklärung würde bedeuten, dem Generalbundesanwalt alle nötigen Akten aus Hessen zur Verfügung zu stellen. Wir erleben aber seit Tagen, dass dies nicht geschieht. Das hessische Landesamt für Verfassungsschutz hat sich nur bereit erklärt, die Akte von Stephan Ernst selbst zu übermitteln. Aber die Akten der Nachuntersuchung des Landesamts für Verfassungsschutz zum NSU sollen nach wie vor für 120 Jahre unter Verschluss gehalten werden. Auch die Bundesanwaltschaft hat sie bisher nicht. Bouffier müsste zurücktreten, wenn er weiterhin die Aufklärung behindert, wie schon im Fall des NSU-Mordes an Halit Yozgat 2006.“


Quellen und Anmerkungen:

(1) http://www.nrhz.de/flyer/beitrag.php?id=26602
(2) https://www.youtube.com/watch?time_continue=12&v=bLYZOwXgoTY
(3) https://www.nachdenkseiten.de/?p=34749
(4) https://www.taz.de/Kommentar-Geheimhaltungsfrist-beim-VS/!5423654/
(5) http://www.jungewelt.de/2016/07-25/012.php
(6) http://www.fnp.de/rhein-main/Verfassungsschuetzer-Temme-Nichts-gesehen-nichts-gehoert;art801,2046682
(7) https://www.heise.de/tp/features/Verfassungsschutz-will-NSU-Bericht-fuer-120-Jahre-wegschliessen-3772330.html
(8) https://www.fr.de/rhein-main/nsu-prozess-ere68532/kannte-bouffier-temme-11057378.html
(9) https://www.zeit.de/gesellschaft/zeitgeschehen/2019-06/tatverdaechtiger-stephan-e-walter-luebcke-rechtsextremes-umfeld
(10) https://www.spiegel.de/panorama/justiz/kasseler-regierungspraesident-walter-luebcke-tod-auf-der-terrasse-a-1270593.html
(11) https://www.zdf.de/nachrichten/heute/linke-wissler-zu-mordfall-luebcke-im-zdf-spezial-100.html
(12) https://www.tagesschau.de/investigativ/panorama/luebcke-verdaechtiger-waffe-101.html
(13) https://www.fr.de/politik/hessen-verfassungsschuetzer-temme-stephan-befasst-13126669.html
(14) https://www.jungewelt.de/artikel/357516.aufkl%C3%A4rungsblockade-bouffier-m%C3%BCsste-zur%C3%BCcktreten.html

Zum Artikel

Dieser Beitrag erschien zuerst im Rubikon-Magazin.
Dieses Werk ist unter einer Creative Commons-Lizenz (Namensnennung – Nicht kommerziell – Keine Bearbeitungen 4.0 International) lizenziert. Unter Einhaltung der Lizenzbedingungen dürfen Sie es verbreiten und vervielfältigen.


Ein Akt von Staatsterrorismus

Die in den Medien verbreitete Version der Morde von Hanau offenbart immer mehr Widersprüche.

von Jens Bernert

Offiziellen Angaben zufolge soll der erste Mord um 21:58 Uhr stattgefunden haben. Nur zwölf Minuten später soll der Täter samt Auto bei der Wohnung seiner Eltern gewesen sein. Passt ein Massenmord an zwölf Menschen in zwei Stadtteilen Hanaus inklusive Fahrt zu den Eltern in so einen schmalen Zeitkorridor? Das scheint völlig unmöglich. Diese Überlegung stützt den Bericht eines türkischen Augenzeugen, wonach der Täter ein ganz anderer war als Tobias Rathjen. Ein böser Verdacht erhärtet sich: Haben „Staatsorgane“ diese Morde auf dem Gewissen?

Die Mordtat in Hanau offenbart immer mehr Widersprüche. So soll den offiziellen Angaben zufolge der erste Mord um 21:58 Uhr stattgefunden haben. Nur zwölf Minuten später sei der Täter samt Auto bei der Wohnung seiner Eltern gewesen. Ein Massenmord an zwölf Menschen in zwei Stadtteilen in Hanau inklusive Fahrt zu seinen Eltern in nur zwölf Minuten: Das ist völlig unmöglich. Und erhärtet natürlich den Bericht des türkischen Augenzeugen, dass der Täter ein ganz anderer war als Tobias Rathjen.

Einige Widersprüche zu dem Hanau-Komplex — inklusive Augenzeugenbericht, Hinweis auf die NSU-Taten in Hessen sowie die Anschlag-Geschichte in Deutschland — habe ich in dem Beitrag „Hanau-Anschlag und Terror-Vorgeschichte werfen Fragen auf“ gesammelt.

Radio Utopie hat noch mehr und stellt im Beitrag „Gewaltensammlung in Hanau: Eine öffentliche Anklage gegen den Staat“ die richtigen Fragen.

Es ist gruselig. Der Verdacht auf Staatsterrorismus erhärtet sich immer mehr. Da stinkt etwas gewaltig.

Hier einige Zitate aus dem Radio-Utopie-Artikel:

„Nachdem es zunächst hieß, der mutmaßliche Attentäter sei den Behörden unbekannt gewesen, rückte Generalbundesanwalt Peter Frank später damit heraus, dass sich dieser bereits seit 2002 an mehrere Behörden gewandt hatte, u.a. an seine, die Bundesanwaltschaft, Ende 2019, also vor wenigen Monaten. (…) Gestern nun rückte Generalbundesanwalt Frank im Innenausschuss des Bundestages, flankiert von den Präsidenten des Inlandsgeheimdienstes (Bundesamt für Verfassungsschutz) und des B.K.A., damit heraus, dass die U.S.-Bundespolizei F.B.I. ein „Ermittlungsverfahren“ gegen den mutmaßlichen Attentäter betrieb und dass dieser 2018 in die U.S.A. gereist war.“

„Der Massenmord an neun Menschen an zwei Tatorten in zwei Stadtteilen in Hanau, sowie seine anschließende Rückfahrt zur Wohnung seiner Eltern habe zwölf Minuten gedauert. Zwölf Minuten. Erster Mord um 21.58 Uhr, um 22.10 sei sein Auto bereits vor der Wohnung seiner Eltern gestanden.“

Zwölf Minuten! Steht sogar in der Propagandapostille Wikipedia:

„Nach einem Bericht des Generalbundesanwaltes Peter Frank vor dem Innenausschuss des Bundestages hat der Attentäter um 21.58 Uhr zuerst einen Menschen auf offener Straße erschossen. Am ersten Tatort erschien eine Polizeistreife um 22.03 Uhr. Bei der Flucht tötete er einen zweiten Menschen, bevor er weiter zur Shishabar Midnight fuhr und dort vier Schüsse durch die Tür abgab, bei dem ein Opfer starb. Auf der Weiterfahrt tötete er einen weiteren Menschen. Im Vorraum eines Kiosks hat er vier Menschen getötet. In der benachbarten Arena Bar gab es einen Toten und mehrere Verletzte. Die Tatdauer betrug insgesamt etwa zwölf Minuten. Sein Kraftfahrzeug befand sich um 22.10 Uhr am Wohnort seiner Eltern“

Weiter mit den Zitaten aus Radio Utopie:

„Und kurz vor der Tat sei das Fahrzeug des mutmaßlich verrückten und rechtsextremistischen alleinigen Attentäters beim Falschparken in der Nähe des ersten Tatorts aufgefallen. Daraufhin von Beamten des Ordnungsamtes angesprochen — und sicherlich im Nachhinein zweifelsfrei identifiziert —, habe der mutmaßlich verrückte und rechtsextremistische alleinige Attentäter ganz ruhig reagiert und das Fahrzeug umgeparkt.“

Der Sohn erschießt die Mutter und sich selbst, aber den Vater soll das 5 Stunden lang nicht interessiert haben. Er wurde dann „gefunden und in die Psychiatrie gebracht“.

„Wie gut, dass der Vater, den die Polizei dann um 03.03 Uhr in der Wohnung vorfand — er hatte bestimmt nicht die Polizei gerufen, schließlich hatte die ja den Attentäter durch das Kennzeichen identifiziert und außerdem waren ja bloß seine Frau und sein Sohn erschossen worden — ruckzuck in der Psychiatrie weggesperrt wurde. Ein Schock. Er soll ja früher schon mal mürrisch zu den Nachbarn gewesen sein. Also der Vater. Stand in der Zeitung.“

„Phoenix-Korrespondentin Jeanette Klag bemerkte etwas widerwillig zum Schluss, sie habe bei den Abgeordneten ‚Erstaunen wahrgenommen‘. Und zwar darüber, dass eine Woche nach einem Massenmord die Regierung (Generalbundesanwalt, BKA und Inlandsgeheimdienst) immer noch nicht sagen konnten ‚was und welche die Tatwaffen waren‘.“

„‚Im Innenausschuss berichteten die Ermittler, dass man R. an der Treppe zum Keller aufgefunden habe – unweit seiner Sig-Sauer-Pistole. Die Mutter des Attentäters fanden die Beamten im Bett des Wohnzimmers auf, ebenfalls leblos. Zwei Kopfschüsse hatten sie getroffen. Ob tatsächlich R. diese Schüsse abgab und wann genau, wissen die Ermittler offenbar noch nicht.‘

Heute nun das, im ‚Spiegel‘.

‚Die geliehene Czeska entdeckten hessische Kriminalbeamte nach SPIEGEL-Informationen nach der Tat in Rathjens Auto.‘

Also, kleines Update der Verteidigung des Staates: die Tatwaffe soll jetzt also eine Czeska sein, die eine Woche lang wohl irgendwie vergessen, übersehen, überlegt, gezählt, gewogen und für nicht untersuchbar oder dem hiesigen Zombie-Parlament als nicht präsentierbar erachtet worden war.

Hm. Wie erschiesst man sich denn mit der Tatwaffe und legt die dann ins Auto? Und sich selbst dann wieder zum Kellereingang?“

Zum Artikel

Dieser Beitrag erschien zuerst im Rubikon-Magazin.
Dieses Werk ist unter einer Creative Commons-Lizenz (Namensnennung – Nicht kommerziell – Keine Bearbeitungen 4.0 International) lizenziert. Unter Einhaltung der Lizenzbedingungen dürfen Sie es verbreiten und vervielfältigen.

Spendenkonto für die Gerichtsverfahren gegen den Stern/Bertelsmann-Konzern

Kommentar hinterlassen