Gesellschaft Medien Politik Wirtschaft Wissenschaft

Pentagon: ZDF fälscht 9/11

Auch einundzwanzig Jahre nach den „Terroranschlägen“ des 11. September 2001 in den USA verbreitet der De-Facto-Staatssender ZDF antiwissenschaftliche Fake News zu dem Thema 9/11, um die wahren Täter und deren Ziele wie Plünderkriege, Bevölkerungsüberwachung, Weltdominanz und dergleichen zu schützen. Etwas anderes kann man mittlerweile nicht mehr folgern, denn zu oft wurde das ZDF schon über seine diesbezüglichen Fehlleistungen informiert, bei denen es sich also nicht mehr um „bedauerliche Zufälle“ oder Unwissen handeln kann.

Der offiziellen Theorie zufolge sollen ja 9-11-Täter aus Hamburg stammen. Da setzt das ZDF mit seiner Sendung Terra X vom 11.9.2022, die auch bei Youtube zur Verfügung steht, dann an: Wer war Terrorpilot Atta? – Die Anschläge vom 11. September 2001 | Terra X.

In dem ZDF-Machwerk wird auch eine „Animation“ des Anschlags auf das Pentagon-Gebäude in Arlington (US-Verteidigungsministerium) verwendet. Diese entspricht in keiner Weise der „offiziellen“ schrägen (angeblichen) Anflugstrecke des angeblich eingeschlagenen Boeing-757-Flugzeuges. Mal ganz abgesehen davon, dass die Bilder vom „Tatort Pentagon“ belegen, dass hier mit absoluter Sicherheit kein großes Verkehrsflugzeug eingeschlagen ist.

Die Pentagon-Anschlagstelle in der „Animation“ ist auch eine ganz andere als die Stelle in der Realität und der ganz offiziell „vom Flugzeug getroffene Transformator/Generator“ im Vorfeld des Pentagon ist auch nicht vorhanden. Die Reihe der Kritikpunkte ließe sich noch lange fortsetzen.

Aufklärende Bilder zu dem „Anschlag am Pentagon“ und mehr zu 9/11 finden Sie hier unten im Anschluss an den Artikel. Wieso verwendet das ZDF eigentlich nicht diese Bilder? Es sind amtliche Fotos von kleinen US-Behördenmitarbeitern vor Ort. Diese sind nach US-Recht sogar Public Domain und frei verfügbar. Und die Bilder zeigen, dass das ZDF lügt.

Es ist schon bemerkenswert, wieviel Bullshit, Fake News, Anti-Wissenschaft und Lügen man in wenigen Sekunden Filmmaterial unterbringen kann. Der Rest des Films ist natürlich auch nicht besser.


Offizielle Fotos der 9/11-Anschlagsorte Pentagon und Shanksville

Bei der Betrachtung der berühmten „Terroranschläge des 11. September 2001 in den USA“ stehen meist die Anschlagstellen in New York im Mittelpunkt, insbesondere die beiden eingestürzten großen World-Trade-Center-Türme WTC1 und WTC2. Der ebenfalls eingestürzte Hochhausturm WTC7, der definitiv nicht Ziel eines Flugzeug-Selbstmordangriffs war, erfährt hingegen kaum Beachtung.

Ebenso wenig im Rampenlicht stehen in der Regel die beiden „kleinen Terroranschlagsorte“ in Shanksville und Arlington, die jeweils auch Absturzstelle eines entführten Passagierflugzeuges sein sollen. In beiden Fällen war das Flugzeug jeweils eine Boeing 757. Während der Tatort Shanksville in Pennsylvania mehr oder weniger zufällig an diese Rolle kam, war das „Terrorziel“ in Arlington gezielt ausgewählt: Das US-Verteidigungsministerium, auch „Pentagon“ genannt – nach dem Pentagon-Gebäude in Arlington.

Eine Analyse der Anschlagsorte in Arlington und Shanksville beziehungsweise der dort von US-Behördenmitarbeitern direkt nach den „Terroranschlägen“ gemachten Fotos lohnt sich. Denn natürlich bricht mit dem Zusammenbrechen der amtlichen Story zu einem einzigen Tatort auch die komplette Geschichte von den angeblichen radikalislamistischen Terroranschlägen in den USA durch Osama bin Laden und seine neunzehn mit Teppichmessern bewaffnete Arabern zusammen.

Hier im folgenden US-Behörden-Fotos vom Anschlagstag 11. September 2001 aus Shanksville und Arlington, gemacht nicht von „Verschwörern“, sondern von kleinen Mitarbeitern vor Ort, die „nur ihren Job erledigt“ haben. Bei einigen sind zur Verdeutlichung rote Quadrate etc. eingezeichnet. Alle Originalfotos beziehungsweise Originalquellen dazu sind verlinkt. Alle Fotos stehen öffentlich im Internet.

Bild 1: Amtliche Boeing-757-Einschlagstelle in Arlington am Pentagon am 11. September 2001. Foto oben links: Direkt nach dem Einschlag, Bild der US Navy. Foto mittig links: Kurz vor dem Zusammensturz mit offizieller „quadratischer“ Einschlagstelle in der unteren Mitte des Bildes, Bild des US Marine Corps, Wikimedia. Foto unten links: Nach dem Zusammenbruch, Bild der US Air Force, Wikipedia. Rechts: Auszug aus einem PDF der Bundeswehr mit einem Beitrag zum „Anschlag auf das Pentagon“ am 11. September 2001.

Bild 2: Offizielle Einschlagstelle der Boeing 757-223 im Pentagon sowie eine Boeing 757-223 der American Airlines, Fotos von US Marine Corps, Wikipedia.

Bild 3: Offizielle Einschlagstelle der Boeing 757-223 im Pentagon sowie eine Boeing 757-223 der American Airlines, Fotos aus WikimediaWikipedia.

Bild 4: Offizielles angebliches Einschlagloch der Boeing 757. Links: Foto der US Navy. Rechts: Foto des US Marine Corps, Wikimedia.

Bild 5: Links das Pentagon nach dem „Einschlag“ mit intaktem Erdgeschoss, Bild der US Navy. Rechts: später sind die Außenmauern weg, Bild der US Navy.

Bild 6: Offizielles Boeing-757-Einschlagsloch sowie Erdgeschoss, Fotos (von links nach rechts) von US Marine Corps/WikimediaUS Navy und nochmal US Navy.

Bild 7: Links die offizielle „Boeing-Einschlagstelle“, Foto des US Marine Corps, Wikimedia. Rechts: Offizieller schräger Einschlag ins Pentagon, amtliche Grafik der US Navy, abrufbar unter history.navy.mil.

Bild 8: Links angebliche Einschlagsstelle eines Fahrwerks im mittleren inneren Ring, Foto des US-Verteidigungsministeriums, Wikimedia. Rechts der offizielle Einschlagswinkel, amtliche Grafik der US Navy.

Bild 9: Vier Bilder der 9/11-Pentagon-Einschlagstelle. Links oben: kurz nach dem „Boeing-Einschlag“. Andere Fotos: kurz vor dem Zusammenbruch des Gebäudeteils. Fotos von US NavyUS Marine CorpsWikimedia.

Bild 10: Impact-Stelle am Pentagon kurz nach dem „Flugzeugeinschlag“ und später vor dem Zusammenbruch. Fotos von US Navy und nochmal US Navy.

Bild 11: Offizielle Einschlagstelle der Boeing 757-223 im Pentagon sowie eine Boeing 757-223 der American Airlines, Fotos von US NavyWikipedia.

Bild 12: Offizielle Einschlagstelle der Boeing 757-223 im Pentagon sowie eine Boeing 757-223 der American Airlines, Fotos von US NavyWikipedia.

Bild 13: Erdgeschoss unter und rechts der offiziellen Boeing-757-Einschlagstelle im Pentagon. Links: Kurz nach dem vermeintlichen Einschlag ist das Erdgeschoss noch vorhanden. Fotos von US Navy und nochmal US Navy.

Bild 14: Während die Fenster um die angebliche Boeing-757-Einschlagstelle unversehrt sind, sind die Fenster an der angeblichen Einschlagstelle eines Flugzeug-Fahrwerks im inneren Ring C „irgendwie“ zerbrochen worden. Fotos von WikimediaWikipedia, Verteidigungsministerium der USA – „Hole Truth: Flight 77’s landing gear punched a 12-ft. hole into the Pentagon’s Ring C.“.

Bild 15: Links ein Foto der US Navy, mit der offiziellen Boeing-Einschlagstelle direkt nach dem „Anschlag“. Kein Scherz: Rechts ein Screenshot mit einem Foto der US Navy mit dem Titel „Die ersten Feuerwehrteams beginnen mit den Löscharbeiten in den Minuten nach dem Anschlag, 11. September 2001“.

Bild 16: Die Taktik der Rettungskräfte beinhaltete offenbar die Entfernung tragender Mauern und den Einsatz von Holzpaletten. Links ein Foto der US Navy, mit der offiziellen Boeing-Einschlagstelle direkt nach dem „Anschlag“. Rechts ein Foto des US Military Health System.

Bild 17: Amtliche Boeing-757-Einschlagsstelle in Arlington am Pentagon bei 9/11. Foto oben rechts: Direkt nach dem Einschlag, US Navy. Foto links: Kurz vor dem Zusammensturz mit offizieller „quadratischer“ Einschlagstelle in der unteren Mitte des Bildes, US Marine Corps, Wikimedia. Foto unten rechts: Nach dem Zusammenbruch, US Air Force, Wikipedia.

Bild 18: Rechts die offizielle schräge Anflugroute des Verkehrsflugzeuges auf das Pentagon, Grafik der US Navy. Links ein Foto der US Army mit „geradem Schadensbild“, Aufnahme nach dem Einbrechen der Obergeschosse.

Bild 19: Offizielle Absturzstelle von Flug 93 auf dem Feld in Shanksville, Pennsylvania, 11. September 2001. Der links in Großaufnahme zu sehende Krater ist im rechten unteren Foto genau in der Mitte zu sehen. Die beiden Fotos wurden von US-Behörden hergestellt und sind Public Domain, beispielsweise bei Wikipedia und Wikimedia erhältlich. Rechts oben das „Shanksville-Flugzeug“ drei Tage vor seiner Entführung, Wikipedia.

Bild 20: Offizielle Absturzstelle von Flug 93 auf dem Feld in Shanksville, Pennsylvania, 11. September 2001. Wikipedia und Wikimedia.

Bild 21: Offizielle Absturzstelle von Flug 93 (eine Boeing 757) auf dem Feld in Shanksville, Pennsylvania, 11. September 2001. Wikipedia.

Bild 22: Offizielle Absturzstelle von Flug 93 auf dem Feld in Shanksville, Pennsylvania, 11. September 2001. Wikimedia.

Bild 23: Offizieller Einschlagskrater von Flug 93 im deutschsprachigen Wikipedia-Artikel „Terroranschläge am 11. September 2001„. Links direkt im Text, rechts das Artikel-zugehörige Großbild bei Klick auf das kleine „Textbild“. Bildbeschriftung: „10:03 Uhr: UA93 stürzt bei Shanksville ab. Aufnahme vom Einschlagskrater. US Government. Public domain“.

Der Elfte September

Die False-Flag-Attacken vom 11.9.2001 und ihre Auswirkungen offenbaren den blanken Rassismus der Westlichen Wertegemeinschaft und ihren Kampf gegen Wissenschaft und Aufklärung.

Vor zwanzig Jahren zog sich die US-Regierung einen Freifahrtschein für einen „War on Terror“, mit dem der Erdball vor allem im globalen Süden überzogen wurde und der Millionen Ausländern den Tod brachte. An der Heimatfront und bei den Verbündeten wurden die eigenen Bürger zurechtgestutzt und „eingedost“. Dass die offizielle Story zu den vorgeblich von der Terrororganisation Al Qaida unter ihrem Führer Osama bin Laden durchgeführten Anschlägen in den USA nicht nur voll von Widersprüchen, sondern für jeden Menschen, der einigermaßen bei Verstand und guten Willens ist, klar als „Bullshit“ zu identifizieren ist, aber trotzdem durchgesetzt wird, scheint für viele der selbsternannten Herren der Menschheit eher ein befriedigender Potenzbeweis als ein Problem zu sein. Wer in der Coronakrise sagt „aber, aber, das würden die doch niemals tun“, der sieht bei 9/11 deutlich, dass sie es tun und schon getan haben, wenn auch auf etwas niedrigerem Level.

Gleich eingangs soll hier an einem einfachen und für jeden klar verständlichen Beispiel gezeigt werden, dass die offizielle Geschichte des Elften Septembers falsch ist und US-Regierung und Co Täter sind und keine Opfer. Wer nach Ansicht der Bilder der offiziellen Einschlagstelle am Pentagon, dem Sitz des US-Verteidigungsministeriums, immer noch behauptet, bei Kritikern der amtlichen 9/11-Theorie handele es sich um Spinner oder Antisemiten, und jegliche Diskussion ablehnt, der spuckt auf die Grundlagen der Physik und den Menschenverstand und will vielleicht einen Kampf gewinnen, in dem er sich wähnt, aber sicher keine Aufklärung der wirklichen Umstände betreiben.

Bild 1: Amtliche Boeing-757-Einschlagsstelle in Arlington am Pentagon bei 9/11. Foto oben rechts: Direkt nach dem Einschlag, US Navy (1). Foto links: Kurz vor dem Zusammensturz mit offizieller „quadratischer“ Einschlagstelle in der unteren Mitte des Bildes, US Marine Corps, Wikimedia (2). Foto unten rechts: Nach dem Zusammenbruch, US Air Force, Wikipedia (3).

Schon ein Blick auf die vermeintliche Pentagon-Einschlagstelle in Arlington zeigt, dass hier kein Passagierflugzeug von ungefähr 50 Meter Länge mit einer Flügelspannweite von 38 Metern und einem Gewicht von über 100000 Kilogramm plus zehntausender Liter Treibstoff – der Flug sollte nach Los Angeles gehen – ein kleines Mauerloch verursacht hat, und das, ohne die umliegenden Fenster zu beschädigen. Auf dem US-Navy-History-Foto oben rechts, das die Situation direkt nach dem Einschlag zeigt, sieht das Verhalten der umstehenden Personen eigentlich eher nach einer Übung samt Evakuierung als nach katastrophalem Ernstfall aus. Den offiziellen Angaben zufolge sind hier gerade alleine am Boden, ohne Flugzeuginsassen, 125 Menschen gestorben – oder liegen zu diesem Zeitpunkt noch im Sterben (4). Das Foto links zeigt die Situation später, kurz vor dem Gebäude-Zusammensturz, samt offizieller „quadratischer“ Einschlagstelle. Das Foto unten rechts zeigt diese Stelle später während der Bergungsarbeiten, nach dem Zusammenbruch dieses Gebäudeteils.

Bild 2: Rechts die offizielle schräge Anflugroute des Verkehrsflugzeuges auf das Pentagon, Grafik der US Navy (5). Links ein Foto der US Army mit „geradem Schadensbild“, Aufnahme nach dem Einbrechen der Obergeschosse (6).

Da im Bereich der angeblichen Katastrophenstelle der frontale Anflug auf das Pentagon-Gebäude für ein Flugzeug im Tiefflug so gar nicht möglich – da verbaut – ist, musste man sich hinsichtlich der vermeintlichen Anflugroute des Flugzeuges etwas einfallen lassen und hat die hier oben im Bild rechts zu sehende Grafik veröffentlicht, welche die offizielle Anflugroute der Boeing-757 zeigt: Schräg ins Gemäuer, gerade noch so an dem Generator vorbei, der neben den Baucontainern steht. Dass dieser „schräge Vogel“ dem Vergleich mit der Realität nicht standhält, zeigen die oben gezeigten Fotos der offiziellen Impact-Stelle. Man beachte auch die beeindruckende Stabilität der Mauern links, die dem angeblich schräg in sie rein einschlagenden Flugzeug genauso gut standhielten wie die Fenster über der „Einschlagstelle der Boeing 757“.

Wissenschaft, Aber-Aber-Ritual und Antisemitismus

Beliebt als „Angriffswerkzeug“ nach dem Verweis auf solche Bilder ist die Unterstellung, man würde behaupten, in die beiden WTC-Türme in New York seien ja gar keine Flugzeuge eingeschlagen. „Aber, aber, ich habe doch mit eigenen Augen die Flugzeuge in die Türme einschlagen sehen!“ heißt es dann, einhergehend mit der stillschweigenden, aber druckvollen Behauptung, der Kritiker sei ein Spinner. Nur ist es eben so, dass bei den Anschlagsstellen in New York im Wesentlichen die Art und Weise des Zusammenbruchs der Zwillingstürme Stunden nach den Einschlägen kritisiert wird, der nach Art einer geplanten Sprengung ablief, und darüber hinaus der Zusammenbruch beziehungsweise die Sprengung eines weiteren Turms neben diesen beiden Türmen, WTC-7, in den kein Flugzeug flog. Die wirkliche wissenschaftliche Antwort auf diese Unterstellung, die ja de facto ein Ablenkungsmanöver ist, und sei es aus Verzweiflung, weil man die Realität nicht wahrhaben will oder geschockt ist, ist aber, dass die Ereignisse in New York hier gar nicht relevant sind. Bricht eine Säule der offiziellen Theorie zusammen, bricht alles zusammen. Das nennt man Wissenschaft. Es wird doch nicht eine Lüge dadurch geheilt, dass man an einer anderen Stelle – vermeintlich – Recht hat. So funktioniert das nicht. Man kann nicht einfach so lange ein „Aber-Aber-Ritual“ durchführen, bis das Gegenüber – vermeintlich – keine Antwort mehr hat, indem es beispielsweise an der Forderung gescheitert ist, alle Schuhgrößen der damaligen Hausmeister der WTC-Türme auswendig und korrekt Personen zugeordnet aufzusagen, nur um dann selbst halb im Wahn zu brüllen „Ha, ich hatte doch recht! Stimmt ja gar nicht! Stimmt ja gar nicht!“. Was hier spaßeshalber etwas übertrieben dargestellt wurde, findet vom Grundprinzip her ständig statt, hat aber mit Wissenschaft und Aufklärung nichts zu tun.

Eine beliebte Waffe gegen Wissenschaftler und andere Zweifler ist neben dem Propagandaclaim „irrer Verschwörungstheoretiker“ und dem Aber-Aber-Ritual der – haltlose – Antisemitismusvorwurf. Selbstverständlich gibt es keinen wissenschaftlichen Zusammenhang zwischen der Forderung nach einer naturwissenschaftlich-physikalischen Betrachtung von Ereignissen und Hass auf Juden. Das ist doch völlig irrwitzig. Vor dem zwanzigsten Jahrestag der 9/11-Terrorangriffe kann man allerdings in den Medien Folgendes finden:

Bild 3: Links der Tagesspiegel (7), rechts der NDR zu 9/11 und Antisemitismus (8).

Der Berliner Tagesspiegel schreibt am 10.9.2021:

„Antisemitismus und Fake News: Wie sich Verschwörungstheorien nach 9/11 unter Berliner Jugendlichen ausbreiteten. Immer wenn etwas Böses passiert, wird nach Sündenböcken und alternativen Fakten gesucht. Woher Verschwörungsmythen nach 9/11 kamen und wer sie weiterverbreitet hat.“

Beim ARD-Sender NDR heißt es zur Sendung ZAPP vom 8.9.2021:

„9/11 und Verschwörungstheorien: 20 Jahre danach. 20 Jahre nach dem 11. September 2001 werden noch immer krude Verschwörungsmythen über die Attentate verbreitet: in sozialen Medien, Dokus oder im Deutschrap. Stets werden darin Schuldige ausgemacht – und zwar keine islamistischen Terroristen. Mal steckt angeblich die US-Regierung dahinter, mal eine ‚jüdische Weltverschwörung‘. Was macht das mit den Hinterbliebenen? Welche Folgen hat das für Jüdinnen und Juden, die mit diesen oft antisemitischen Verschwörungsnarrativen angefeindet werden? Und welche Verantwortung tragen die Plattformbetreiber, die solche Inhalte zur Verfügung stellen?“

Der Antisemitismusvorwurf gegen Kritiker offizieller Narrative wird mittlerweile im Prinzip beliebig eingesetzt, wie nicht nur bei 9/11, sondern vor auch in der Coronakrise und bei anderen Themen zu beobachten ist. Dabei macht die Antisemitismusverleumdung nicht einmal vor Juden halt (9). So musste sich beispielsweise die kürzlich verstorbene Auschwitz-Überlebende und überzeugte Antifaschistin Esther Bejarano von nicht-jüdischem deutschen „Jungvolk“ als Antisemitin beschimpfen lassen, weil sie dessen Ansichten nicht teilte, und Moshe Zuckermann, Professor für Geschichte und Philosophie sowie jüdischer Sohn von Holocaust-Überlebenden, erleidet das gleiche Schicksal, wie er in einem Interview berichtet (10, 11). Bei den verleumdenden Personen handelt es sich im Wesentlichen um die gleichen Pseudolinken, die sich heute in der Coronakrise für Machteliten-Politik prügeln wollen, und keine tatsächlichen Linken, sondern eher dauerbeleidigte Wohlstandskinder darstellen. Ein wesentlicher Teil dieser lautstarken Gruppen sind sich selbst als „Antideutsche“ betitelnde Personen, die eben auch, zusätzlich zu einigen Journalisten, Politikern etc., beim Thema 9/11 aktiv sind. Der Schutz der westlichen Machteliten ist für sie gleichbedeutend mit „Kampf gegen Antisemitismus“. Einen ungefähren Einblick in diese „Denkweise“ erlaubt ein Auszug aus einem Interview bei Neues Deutschland vom November 2014 mit der in antideutschen Kreisen äußerst beliebten Band „Antilopengang“, die von der Band Die Toten Hosen – gefallene Punkrock-Helden mit Hang zur Merkel-Verehrung – stark gefördert wird (12, 13):

„Danger Dan: Also Blockupy fand‘ ich schon besonders dumm. Diese Idee es gäbe irgendwie 99% von Unterdrückten, die von einem Prozent Reicher unterdrückt werden – ein besseres Beispiel für verkürzte Kapitalismuskritik gibt’s eigentlich gar nicht. Da würde auch die NPD unterschreiben und mitmachen.

Koljah: Das ist ja auch schon fast Antisemitismus. Da ist ja schon der Aufruf zum Pogrom impliziert.

Danger Dan: Das das überhaupt noch geht, dass Linke sich auf so einen Unsinn einigen können, hat mich krass verwundert. Da bin ich dann doch sehr froh über Rechtsstaatlichkeit, über Polizisten, die diese Leute dann im Zaum halten. Und ich würde auch tatsächlich, wenn diese Leute sich erheben und das umsetzen wollen, was da zwischen den Zeilen angekündigt wird, dieses reiche eine Prozent – wer auch immer das sein soll – wenn die die jetzt lynchen würden, würde ich auch auf der Seite der Polizei gegen sie kämpfen. Mit Waffengewalt.

Koljah: Ich muss sagen: mich hat’s überhaupt nicht verwundert. Sondern das steht in der Tradition einer Linken, die in Deutschland spätestens seit 68 antisemitisch durchsetzt ist. Das passt dazu. Diese ganzen Proteste, die so tun als könne man nur »das Finanzkapital« kritisieren, die ein Bild von »guter Kapitalismus gegen schlechter Kapitalismus« zeichnen, bieten genau den Anknüpfungspunkt für Antisemitismus. […]

Danger Dan: Da wo solche abstrakten Probleme auf irgendwelche Minderheiten oder am Ende noch die Juden projiziert werden, bin ich aus dem Spiel raus und hab keine Lust darauf. Ich bin dann sehr skeptisch und bei mir gehen die Alarmglocken an. Und im Fall von Antisemitismus sind Juden die, die als Juden angegriffen werden. Das hat nichts mit Religion zu tun.“

Bizarre Claims

Eingangs wurde bereits aufgezeigt, dass die amtliche Verschwörungstheorie von Osama bin Laden, der aus einer Höhle in Afghanistan heraus neunzehn mit Teppichmessern bewaffnete Islamisten dirigierte, die in den USA vier Flugzeuge kaperten und damit die 9/11-Anschläge begingen, nicht haltbar ist. Auch das „Loch von Shanksville“ zeigt dies noch einmal deutlich auf. Hier war wie in Arlington am Pentagon ebenfalls kein Flugzeug am Werk:

Bild 4: Offizielle Absturzstelle von Flug 93 auf dem Feld in Shanksville, Pennsylvania, 11. September 2001. Der links in Großaufnahme zu sehende Krater ist im rechten unteren Foto genau in der Mitte zu sehen. Die beiden Fotos wurden von US-Behörden hergestellt und sind Public Domain, beispielsweise bei Wikipedia und Wikimedia erhältlich (14, 15, 16). Rechts oben das „Shanksville-Flugzeug“ drei Tage vor seiner Entführung, Wikipedia (17).

Wie jeder sehen kann, zeigen die beiden offiziellen Fotos der 9/11-Shanksville-„Absturzstelle“, dass dort kein großes Verkehrsflugzeug abgestürzt ist. Man sieht einen kleinen Einschlagskrater von vielleicht gerade Mal fünf Metern Durchmesser. Man beachte die Fahrzeuge und Bäume im rechten unteren Bild und vergleiche das mit dem kleinen Krater in der Mitte dieses Fotos. Man beachte die beiden Menschen mit den weißen Hosen, die neben dem links in Großaufnahme zu sehenden Krater stehen. Dieses Mini-Loch kann niemals die Einschlagstelle einer Passagiermaschine sein.

Dass an der ganzen 9/11-Story etwas faul ist, hätte man sich allerdings auch ohne die gezeigten Bilder bereits denken können. Die Kurzfassung:

1. USA gründet Al Qaida („Mudschaheddin“) – sagt selbst Hillary Clinton (18).

2. „Al Qaida“ begeht laut USA 9/11-Anschläge (3000 Tote) in 2001 in USA (19).

3. USA und Al Qaida überfallen gemeinsam Syrien (seit 2011), Libyen, Yemen…(20)

Die Figur „Osama bin Laden“ taucht nicht erst mit den Anschlägen in den USA auf der Bildfläche auf. Osama bin Laden war vorher ganz offiziell „unser Mann in Afghanistan“, wo er als Führer der Qaida für die US-Amerikaner gegen die sowjetischen und afghanischen Truppen kämpfte (21). Es gibt da dieses berühmte Foto von Bin Laden in einem nicht weniger berühmten Artikel der britischen Zeitung Independent aus dem Jahre 1993, der den amtlichen Terroristenchef als unseren Helden im Kampf gegen die Sowjetunion in Afghanistan feiert.

Bild 5: Foto des Independent-Artikels zu Bin Laden (22).

Der Independent hat mittlerweile das Bin-Laden-Foto aus der Onlineversion des Artikels entfernt („Photograph omitted“). In dem Artikel mit der Überschrift „Anti-Soviet warrior puts his army on the road to peace: The Saudi businessman who recruited mujahedin now uses them for large-scale building projects in Sudan. Robert Fisk met him in Almatig“ von 1993 geht es um die – angebliche – Zeit der Figur Bin Laden nach dem Kampf seiner Mudschaheddin-Jihadisten – später als „Al Qaida“ tituliert – gegen die sowjetische Armee in Afghanistan: Er hielt sich danach laut Independent-Artikel im Sudan auf und soll sich dort im Straßenbau verdient gemacht haben (22).

Als 2016 im Syrienkrieg der Kampf der syrischen Truppen gegen die die prowestlichen Besatzer von Aleppo anstand, konnte man einen Sprecher des US-Verteidigungsministeriums folgendes sagen hören (23):

“That said, it’s primarily al-Nusra who holds Aleppo”

Al Nusra ist der in Syrien tätige Arm der Al Qaida und das bestreitet weder Freund noch Feind. Mittlerweile wurde Al Nusra umbenannt etc.. Die Qaida – „Rebellen“ genannt – hielt also nach Angaben des US-Militärs Aleppo beziehungsweise Ost-Aleppo, vom Westen unterstützt und mit Waffen beliefert. Bekannt war das schon lange vor der hier zitierten Aussage und blitzte auch schon Mal bei TagesschauSpiegel und Co durch (24, 25, 26).

al_kaida_christoph_sydow_spiegel

Bild 6: Screenshot aus Spiegel Online, hoffen auf Al-Qaida-Truppennachschub (26, 27).

An diesem Punkt stellt sich doch jedem, der klar bei Verstand ist, die Frage, wie es denn bitte sein kann, dass man als US-Regierung beziehungsweise Westliche Wertegemeinschaft auch nur in Erwägung zieht, mit Al Qaida zu kämpfen beziehungsweise diese einzusetzen, geschweige denn, dies tatsächlich wenige Jahre nach den vorgeblichen Jahrhundertanschlägen der Al Qaida in den USA auch zu tun. 2011 begann der als „syrischer Bürgerkrieg“ getarnte Angriff auf Syrien, unter anderem mit ausländischen Kämpfern von Al Qaida, und quasi parallel dazu hat man ganz offiziell die Figur Osama bin Laden entsorgt, der den amtlichen Angaben zufolge am 2. Mai 2011 in Pakistan nicht etwa festgenommen, sondern getötet wurde, und dessen Leiche man leider direkt entsorgt hat… Wikipedia schreibt zu Letzterem (28):

„Bin Ladens Identität wurde nach Angaben der US-Regierung mit einer DNA-Analyse festgestellt und sein Leichnam noch am 2. Mai 2011 an geheimer Stelle von Bord des US-Flugzeugträgers USS Carl Vinson im Arabischen Meer bestattet.“

Ein neues blutiges Jahrhundert, im Notstand

Der Nationale Notstand in den USA, der aufgrund der „9/11-Al-Qaida-Angriffe“ erlassen wurde, wird seit 20 Jahren jedes Jahr vom jeweiligen US-Präsidenten verlängert. Bush, Obama, Trump und jetzt Biden am 9. September 2021 (29): Sie alle verlängerten immer wieder ihre Notstandsbefugnisse in einer „Notice on the Continuation of the National Emergency with Respect to Certain Terrorist Attacks“.

Der „War on Terror“ seit 2001 hat außerhalb des Westens Millionen Menschenleben gekostet, die bei den Führern und Aktivisten der Westlichen Wertegemeinschaft keine Bedeutung zu haben scheinen. Der blanke Rassismus. Dazu hat man noch ein paar hundert Unschuldige eingefangen, die selbstverständlich mit den Terrorattacken von 9/11 nichts zu tun haben können, wie wir bereits eingangs mit der Aufdeckung des False-Flag-Charakters der Anschläge gesehen haben, und hat sie zum demonstrativen Durchfoltern in Guantanamo oder zur heimlichen Folter an noch finstereren Orten eingekerkert. Einige sitzen da heute noch. Alles offenbar „scheißegal“. Der blanke Rassismus. Der Gefangene Ahmed Rabbani hat Anfang 2021 einen Brief an US-Präsident Biden geschrieben, aus dem hier ein kleiner Auszug zitiert werden soll (30, 31):

„Als ich 2002 in Karachi gekidnappt wurde und an die CIA für ein Kopfgeld verkauft wurde mit einer falschen Story, dass ich ein Terrorist namens Hassan Gul sei. Meine Frau und ich hatten gerade die gute Auskunft bekommen, dass sie schwanger war. Ein paar Monate später gebar sie meinen Sohn Jawad. Mir wurde niemals erlaubt, mein eigenes Kind zu sehen. Präsident Biden ist ein Mann, der von der Bedeutung der Familie spricht. Ich frage mich, ob er sich vorstellen kann, was es bedeutet, niemals den eigenen Sohn berührt zu haben. Meiner wird bald 18 Jahre alt sein und ich bin nicht dort gewesen, um ihm zu helfen oder ihn zu leiten. (…)

Der Bericht des Geheimdienstausschusses des Senats über die CIA-Folter wurde ‚unter seiner Aufsicht‘ 2014 abgeschlossen, wie man sagt. Es ist ein Report, in dem ich vorkomme. Darin steht, dass ich 540 Tage gefoltert wurde in einem ‚Dunkel-Gefängnis‘ in Afghanistan ‚ohne Erlaubnis‘ – ob das besser oder schlechter ist, kann ich nicht entscheiden

Ich kann bestätigen, dass die Folter stattfand, obwohl ich die Tage und Nächte nicht selbst zählen konnte: die Tage und Nächte flossen zu einem Block zusammen, als ich in einer finsteren Grube an einer Stange aufgehängt war und mir die Arme unter Qualen aus den Schultern auskugelten.

Ich zweifle, ob Präsident Biden verstehen kann, was diese Folter bedeutet; eine Frau im Nebenraum schreien zu hören und einem gesagt wird, dass es deine Frau ist, und dass, wenn ich nicht tue, was sie sagen, sie vergewaltigt oder getötet wird.“

Türme und noch ein Einsturz

Jetzt sind wir am Ende des Artikels angelangt und der Einsturz der drei Türme in New York, nachdem zwei davon von Flugzeugen getroffen wurden, der immer so im Fokus steht, wurde gar nicht behandelt. Man muss das auch nicht, um nachzuweisen, dass die Geschichte der US-Regierung zu 9/11 nicht stimmt, wie wir gleich eingangs gesehen haben. Für Interessierte gibt es allerdings genug Material, das aufzeigt, dass die Türme nur gesprengt worden sein können und nicht einfach so zusammengebrochen sind. Glücklicherweise haben sich auch einige aufrechte Physiker und Ingenieure des Themas angenommen und die Sache überprüft und durchgerechnet. Im Prinzip kann aber jeder Amateur schon beim Anschauen der Fall-Videos von WTC-1, WTC-2 und WTC-7 leicht erkennen, dass das jeweils einer Abbruchsprengung eines Hochhauses verdammt ähnlich sieht und dass die Wolkenkratzer fast im freien Fall, ohne Widerstand, zu Boden rauschen, was eben nur durch eine Sprengung möglich ist, wie auch immer diese technisch durchgeführt wurde. Die völlig ausgebrannten Hochhäuser in London und Peking, die im Gegensatz zu dem mit einem Stockwerksbrand „ausgestatteten“ WTC-7 einfach stehengeblieben sind, dürfte wohl auch jeder kennen…(32, 33)

Die offizielle „Theorie“ zu 9/11 ist längst eingestürzt, man muss die Nachricht davon nur noch verbreiten (34-52). Wer dahingehend noch zaudert, dem sei zur Entscheidungsfindung höflichst ein kleines Gedankenspiel empfohlen: Stellen Sie sich vor, Sie würden Ahmed Rabbani bei einem Besuch in Guantanamo Bay gegenüberstehen und sollten ihm erklären, dass sie keine Texte zur Aufklärung von 9/11 weiterverbreiten wollten, weil Sie Angst hatten, dass Sie bei Verbreitung solcher Aussagen vielleicht irgendwann einmal eine Facebook-Sperre hätten bekommen können.

Links

(1) https://www.history.navy.mil/content/history/nhhc/research/library/online-reading-room/title-list-alphabetically/p/pentagon-9-11-footnotes/_jcr_content/body/image_14.img.jpg/1438613592644.jpg
(2) https://commons.wikimedia.org/wiki/File:DM-SD-02-03880.JPEG
(3) https://en.wikipedia.org/wiki/File:Aerial_view_of_the_Pentagon_during_rescue_operations_post-September_11_attack.JPEG
(4) https://en.wikipedia.org/wiki/Victims_of_Terrorist_Attack_on_the_Pentagon_Memorial
(5) https://www.history.navy.mil/content/dam/nhhc/research/library/online-reading-room/pentagon911/pentagon_911-8.jpg
(6) http://blauerbote.com/wp-content/uploads/2021/09/army_mil_pentagon.jpg
(7) https://plus.tagesspiegel.de/berlin/antisemitismus-und-fake-news-wie-sich-verschwoerungstheorien-nach-911-unter-berliner-jugendlichen-ausbreiteten-243077.html
(8) https://www.ndr.de/fernsehen/sendungen/zapp/9-11-und-Verschwoerungstheorien-20-Jahre-danach,gefaehrlichemyth100.html
(9) https://projektkritischeaufklaerung.de/de/konferenz-in-berlin-am-10-februar-2018/
(10) http://blauerbote.com/2021/08/11/dokumentarfilm-zeit-der-verleumder-mit-moshe-zuckermann-rolf-becker-jackie-walker-ali-abunimah-moshe-machover-judith-bernstein-esther-bejarano-u-a/
(11) https://odysee.com/@Punkt.PRERADOVIC:f/Zuckermann:4
(12) http://blauerbote.com/2021/08/02/die-machteliten-die-toten-afrikaner-und-die-absicherung-der-herren-durch-beleidigte-wohlstandskinder/
(13) https://www.nd-aktuell.de/artikel/951837.punk-hat-viele-widerspruechliche-inhalte.html
(14) https://fr.m.wikipedia.org/wiki/Fichier:Flight_93_Crater.jpg
(15) http://blauerbote.com/wp-content/uploads/2019/11/flight_93_crash_crater_911_shanksville_pennsylvania_september11_united_airlines_usa_2001_terror.png
(16) https://commons.wikimedia.org/wiki/File:Flight93Crash.jpg
(17) https://en.wikipedia.org/wiki/United_Airlines_Flight_93#/media/File:N591UA.jpg
(18) http://blauerbote.com/2018/07/27/noam-chomsky-hillary-clinton-we-created-al-qaeda-isis/
(19) http://blauerbote.com/2019/09/20/was-ist-911/
(20) http://blauerbote.com/2018/09/05/laut-usa-und-tagesschau-handelt-es-sich-bei-den-rebellen-in-syrien-um-al-qaida/
(21) http://blauerbote.com/2018/10/08/zbigniew-brzezinski-afghanistan-al-qaida-und-osama-bin-laden/
(22) http://www.independent.co.uk/news/world/anti-soviet-warrior-puts-his-army-on-the-road-to-peace-the-saudi-businessman-who-recruited-mujahedin-1465715.html
(23) http://www.defense.gov/News/Transcripts/Transcript-View/Article/739157/department-of-defense-press-briefing-by-col-warren-via-teleconference-from-bagh
(24) http://blauerbote.com/2017/03/18/syrien-ost-aleppo-wurde-von-al-qaida-beherrscht/
(25) http://blauerbote.com/2018/09/05/laut-usa-und-tagesschau-handelt-es-sich-bei-den-rebellen-in-syrien-um-al-qaida/
(26) http://blauerbote.com/2016/08/02/der-spiegel-feuert-al-kaida-an-die-islamisten-sind-aleppos-letzte-hoffnung/
(27) https://www.spiegel.de/politik/ausland/syrien-die-islamisten-sind-aleppos-letzte-hoffnung-a-1105806.html
(28) https://de.wikipedia.org/wiki/Osama_bin_Laden
(29) https://www.whitehouse.gov/briefing-room/presidential-actions/2021/09/09/notice-on-the-continuation-of-the-national-emergency-with-respect-to-certain-terrorist-attacks/
(30) https://einarschlereth.blogspot.com/2021/02/ich-bin-ein-gefangener-in-guantanamo.html
(31) http://blauerbote.com/2021/02/05/ich-bin-ein-gefangener-in-guantanamo-bay-und-ich-habe-eine-botschaft-fuer-praesident-biden/
(32) http://blauerbote.com/2017/06/14/hochhausbrand-in-london-vs-wtc7-einsturz-bei-911/
(33) https://www.rubikon.news/artikel/20-jahre-terrorluge
(34) http://blauerbote.com/2021/09/09/118-augenzeugen-zu-9-11-das-zeugnis-der-feuerwehrleute-zu-den-explosionen-in-den-zwillingstuermen/
(35) https://www.rubikon.news/artikel/der-verklarte-tag
(36) https://www.rubikon.news/artikel/die-jahrhundertluge
(37) http://blauerbote.com/2016/09/05/physiker-fachblatt-zu-911-world-trade-center-einsturz-durch-kontrollierte-sprengung/
(38) https://www.europhysicsnews.org/articles/epn/pdf/2016/04/epn2016474p21.pdf
(39) https://www.rubikon.news/artikel/die-sprengung
(40) https://kenfm.de/akademische-naivitaet-und-der-11-september/
(41) https://www.amazon.de/Stigmatisierung-statt-Aufkl%C3%A4rung-%C2%BBVerschw%C3%B6rungstheorie%C2%AB-kontrafaktischen/dp/3862420019
(42) https://www.rubikon.news/artikel/selektive-wahrheitssuche
(43) https://www.rubikon.news/artikel/selektive-wahrheitssuche-2
(44) https://www.rubikon.news/artikel/der-pentagon-fake
(45) https://www.rubikon.news/artikel/der-scheinheilige-2
(46) https://www.radio-utopie.de/2016/09/10/15-jahre-terrorkrieg-und-11-september-wie-alles-begann/
(47) https://www.broeckers.com/911-2/
(48) https://www.rubikon.news/artikel/bilanz-eines-jahrhundertverbrechens
(49) http://antikrieg.com/aktuell/2019_08_08_dasverbrechen.htm
(50) http://blauerbote.com/2021/04/08/der-911-verschwoerungswahn/
(51) https://www.broeckers.com/2021/08/06/mythos-9-11-alles-klar-herr-kommissar/
(52) https://www.buchkomplizen.de/buecher-mehr/mythos-9-11.html


Die Unterwerfung der Welt

Die Machteliten arbeiteten schon „vor Corona“ mit Schockereignissen und Realitätsfälschung.

Endlich keine Widerworte mehr, endlich alles unter Kontrolle, endlich alles in den eigenen Händen? Das von den grauen Eminenzen der westlichen Machteliten ausgerufene „Neue Amerikanische Jahrhundert“ begann mit einem „kreativen Paukenschlag“. Jetzt soll mit der Coronakrise ein noch größerer Knall den Planeten, die Wirtschaft, die Bevölkerung, die Körper unter Kontrolle bringen und „endlich“ den Deckel auf den Topf machen. Mit der absoluten Kontrolle soll auch das Glaubwürdigkeitsproblem der Herrschenden beseitigt werden, das sich durch ihre ständig platzenden Propagandalügen ergibt. Es ist wichtig, darauf hinzuweisen, dass die Coronakrise letztlich nur die Fortsetzung des Krieges gegen die Menschheit mit einem anderen Mittel ist und nicht plötzlich und unerwartet über uns hereingebrochen ist. Die Enttarnung der mittlerweile quasi offen von US-Multimilliardären befehligten Machteliten durch die Betrachtung des „ersten Paukenschlags“ 9/11 trägt dazu bei, das Corona-Regime zum Einsturz zu bringen, denn bei den Corona-Tätern und den 9/11-Tätern handelt es sich um die gleiche Bande.

Der Nationale Notstand in den USA, der aufgrund der „9/11-Al-Qaida-Angriffe“ vom 11. September 2001 erlassen wurde, wird seit 20 Jahren jedes Jahr vom jeweiligen US-Präsidenten verlängert. Bush, Obama, Trump und zuletzt Biden am 9. September 2021: Sie alle haben immer wieder die Notstandsbefugnisse in einer „Notice on the Continuation of the National Emergency with Respect to Certain Terrorist Attacks“ verlängert (1).

Der mit der Begründung von angeblich durch radikalislamistische Al-Qaida-Terroristen begangenen „Anschläge des 11. September 2001“ ausgerufene „War on Terror“ hat außerhalb des Westens Millionen Menschenleben gekostet, die bei den Führern und Aktivisten der Westlichen Wertegemeinschaft keine Bedeutung zu haben scheinen.

Der Notstand, die Überwachung und der „War on Terror“ basieren auf bereits auf den ersten Blick erkennbaren bizarren antiwissenschaftlichen Lügen. Selbstverständlich wissen die Soldaten der Bundeswehr beispielsweise, wie es aussieht und was passiert, wenn ein großes Verkehrsflugzeug à la Boeing-757 in eine Hauswand brettert. Wenn also in den Heften und Broschüren des deutschen Militärs „Informationen“ erscheinen, die jeden Betrachter angesichts der gezeigten „Inkompetenz“ vor Lachen vom Stuhl fallen lassen, dann ist das politisch so gewollt. Nicht das Lachen, sondern das Verkaufen bizarrer Falschinformationen als „die reine Wahrheit“.

Bild 1: Amtliche Boeing-757-Einschlagstelle in Arlington am Pentagon am 11. September 2001. Foto oben links: Direkt nach dem Einschlag, Bild der US Navy (2). Foto mittig links: Kurz vor dem Zusammensturz mit offizieller „quadratischer“ Einschlagstelle in der unteren Mitte des Bildes, Bild des US Marine Corps, Wikimedia (3). Foto unten links: Nach dem Zusammenbruch, Bild der US Air Force, Wikipedia (4). Rechts: Auszug aus einem PDF der Bundeswehr mit einem Beitrag zum „Anschlag auf das Pentagon“ am 11. September 2001 (5).

Die Betrachtung der vermeintlichen Pentagon-Boeing-757- Einschlagstelle im US-Verteidigungsministerium in Arlington – Bild oben – zeigt klar auf, dass hier kein – von „Islamisten“ entführtes – großes Passagierflugzeug ein kleines Mauerloch verursacht hat, und das, ohne die umliegenden Fenster zu beschädigen. Auf dem US-Navy-Foto oben links, welches die Situation direkt nach dem Einschlag zeigt, sieht das Verhalten der umstehenden Personen nicht nach einem Katastrophenfall aus. Den offiziellen Angaben zufolge sind hier gerade alleine am Boden 125 Menschen gestorben – oder liegen zu diesem Zeitpunkt noch im Sterben (6). Das Foto mittig links zeigt die Situation später, kurz vor dem Gebäude-Zusammensturz, samt offizieller „quadratischer“ Einschlagstelle. Das Foto unten links zeigt diese Stelle später während der Aufräumarbeiten, nach dem forcierten Zusammenbruch dieses Gebäudeteils. Man beachte auch, dass das Erdgeschoss direkt nach dem Einschlag noch vorhanden ist… Rechts im Bild ein PDF-Dokument der Bundeswehr zu 9/11 mit einer ganz eigenen Vorstellung von Physik und Realität. Textauszug (5):

„Kurz nach 9:37 Uhr flog AmericanAirlines-Flug 77 in das größte Bürogebäude der Welt: das Pentagon. Genau gegenüber der Bundeshauptstadt Washington auf der anderen Seite des Flusses Potomac beendete der Absturz einen eineinviertelstündigen Flug, der am Dulles International Airport bei Washington begonnen hatte. Die Zerstörung, die der Aufschlag der 100 Tonnen schweren Boeing bei 460 Knoten beziehungsweise 235 Metern pro Sekunde mit sich brachte, war verheerend. Die Innenfläche des Pentagon beträgt insgesamt 610 000 Quadratmeter. Der Aufschlag zerstörte sofort etwa vier Prozent dieser Fläche und tötete 125 Personen im Pentagon sowie 59 unschuldige Passagiere an Bord des Flugzeugs. Die circa 18 Tonnen Kerosin an Bord verursachten zusätzlich einen sich schnell ausbreitenden Brand. Dieser gefährdete die etwa 20 000 sich zu dieser Zeit im Gebäude befindenden Menschen sowie die zahlreichen Einsatzkräfte, die innerhalb der nächsten 32 Stunden vor Ort eintrafen. Ein Zufall rettete viele Leben: Die Büros von 4000 Mitarbeitern in der Aufschlagzone waren bereits für begonnen Renovierungsarbeiten im Pentagon geräumt worden.“

Bild 2: Offizielle Einschlagstelle der Boeing 757-223 im Pentagon sowie eine Boeing 757-223 der American Airlines, Fotos von US Marine Corps, Wikipedia (7, 8).

Bild 3: Offizielle Einschlagstelle der Boeing 757-223 im Pentagon sowie eine Boeing 757-223 der American Airlines, Fotos aus WikimediaWikipedia (7, 9).

Bild 4: Offizielles angebliches Einschlagloch der Boeing 757. Links: Foto der US Navy (2). Rechts: Foto des US Marine Corps, Wikimedia (9).

Bild 5: Links das Pentagon nach dem „Einschlag“ mit intaktem Erdgeschoss, Bild der US Navy (2). Rechts: später sind die Außenmauern weg, Bild der US Navy (10).

Bild 6: Offizielles Boeing-757-Einschlagsloch sowie Erdgeschoss, Fotos (von links nach rechts) von US Marine Corps/WikimediaUS Navy und nochmal US Navy (9, 2, 10).

Bild 7: Links die offizielle „Boeing-Einschlagstelle“, Foto des US Marine Corps, Wikimedia (9). Rechts: Offizieller schräger Einschlag ins Pentagon, amtliche Grafik der US Navy, abrufbar unter history.navy.mil (11).

Bild 8: Links angebliche Einschlagsstelle eines Fahrwerks im mittleren inneren Ring, Foto des US-Verteidigungsministeriums, Wikimedia (12). Rechts der offizielle Einschlagswinkel, amtliche Grafik der US Navy (11).

Bild 9: Vier Bilder der 9/11-Pentagon-Einschlagstelle. Links oben: kurz nach dem „Boeing-Einschlag“. Andere Fotos: kurz vor dem Zusammenbruch des Gebäudeteils. Fotos von US NavyUS Marine CorpsWikimedia (2, 7, 13, 3).

Bild 10: Impact-Stelle am Pentagon kurz nach dem „Flugzeugeinschlag“ und später vor dem Zusammenbruch. Fotos von US Navy und nochmal US Navy (2, 14).

Bild 11: Offizielle Einschlagstelle der Boeing 757-223 im Pentagon sowie eine Boeing 757-223 der American Airlines, Fotos von US NavyWikipedia (14, 8).

Bild 12: Offizielle Einschlagstelle der Boeing 757-223 im Pentagon sowie eine Boeing 757-223 der American Airlines, Fotos von US NavyWikipedia (2, 8).

Bild 13: Erdgeschoss unter und rechts der offiziellen Boeing-757-Einschlagstelle im Pentagon. Links: Kurz nach dem vermeintlichen Einschlag ist das Erdgeschoss noch vorhanden. Fotos von US Navy und nochmal US Navy (2, 14).

Bild 14: Während die Fenster um die angebliche Boeing-757-Einschlagstelle unversehrt sind, sind die Fenster an der angeblichen Einschlagstelle eines Flugzeug-Fahrwerks im inneren Ring C „irgendwie“ zerbrochen worden. Fotos von WikimediaWikipedia, Verteidigungsministerium der USA – „Hole Truth: Flight 77’s landing gear punched a 12-ft. hole into the Pentagon’s Ring C.“ (3, 12).

Bild 15: Links ein Foto der US Navy, mit der offiziellen Boeing-Einschlagstelle direkt nach dem „Anschlag“ (2). Kein Scherz: Rechts ein Screenshot mit einem Foto der US Navy mit dem Titel „Die ersten Feuerwehrteams beginnen mit den Löscharbeiten in den Minuten nach dem Anschlag, 11. September 2001“ (15).

Bild 16: Die Taktik der Rettungskräfte beinhaltete offenbar die Entfernung tragender Mauern und den Einsatz von Holzpaletten. Links ein Foto der US Navy, mit der offiziellen Boeing-Einschlagstelle direkt nach dem „Anschlag“ (2). Rechts ein Foto des US Military Health System (16).

Die Propaganda behauptet, wer nicht an die offizielle Story zum 11. September 2001 glaubt, sei ein irrer Verschwörungstheoretiker und Antisemit. Das gleiche Vorgehen erleben wir jetzt auch bei der Coronakrise. Beim Anblick der Originalbilder zu 9/11 wird klar, wo hier die Wahnsinnigen zu verorten sind. Mit der Coronakrise soll die totale Kontrolle und Unterwerfung dauerhaft zementiert werden. Je früher man sich dagegen wehrt, desto besser.

Links

(1) https://www.whitehouse.gov/briefing-room/presidential-actions/2021/09/09/notice-on-the-continuation-of-the-national-emergency-with-respect-to-certain-terrorist-attacks/
(2) https://www.history.navy.mil/content/history/nhhc/research/library/online-reading-room/title-list-alphabetically/p/pentagon-9-11-footnotes/_jcr_content/body/image_14.img.jpg
(3) https://commons.wikimedia.org/wiki/File:DM-SD-02-03880.JPEG
(4) https://en.wikipedia.org/wiki/File:Aerial_view_of_the_Pentagon_during_rescue_operations_post-September_11_attack.JPEG
(5) https://www.bundeswehr.de/resource/blob/5201394/30202483f7963933354acac25648cf78/zmg-2021-h2-data.pdf
(6) https://en.wikipedia.org/wiki/Victims_of_Terrorist_Attack_on_the_Pentagon_Memorial
(7) https://publicintelligence.net/wp-content/uploads/2011/09/DM-SD-02-03889.jpeg
(8) https://de.wikipedia.org/wiki/Boeing_757#/media/Datei:N606AA-2008-09-13-YVR_crop.jpg
(9) https://upload.wikimedia.org/wikipedia/commons/d/db/DM-SD-02-03880.JPEG
(10) https://www.history.navy.mil/content/history/nhhc/research/library/online-reading-room/title-list-alphabetically/p/pentagon-9-11-footnotes/_jcr_content/body/image_15.img.jpg
(11) https://www.history.navy.mil/content/dam/nhhc/research/library/online-reading-room/pentagon911/pentagon_911-8.jpg
(12) https://commons.wikimedia.org/wiki/File:911-pentagon-hole-l.jpg
(13) https://commons.wikimedia.org/wiki/File:DM-SD-02-03886.JPEG
(14) https://www.history.navy.mil/content/dam/nhhc/research/library/online-reading-room/pentagon911/pentagon_911-23.jpg
(15) https://www.history.navy.mil/research/archives/digital-exhibits-highlights/photo-galleries-9-11/pentagon-attack/image-04.html
(16) https://health.mil/News/Gallery/Photos/2016/09/11/Pentagon-Ruins

Spendenkonto für die Gerichtsverfahren gegen den Stern/Bertelsmann-Konzern

Kommentar hinterlassen